KEGG   Chlorella variabilis: CHLNCDRAFT_7300Help
Entry
CHLNCDRAFT_7300   CDS       T02924                                 

Definition
(RefSeq) hypothetical protein
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
cvr  Chlorella variabilis
Brite
KEGG Orthology (KO) [BR:cvr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CHLNCDRAFT_7300
Enzymes [BR:cvr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     CHLNCDRAFT_7300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1 Flavodoxin_5
Motif
Other DBs
NCBI-GeneID: 17359301
NCBI-ProteinID: XP_005852037
JGI: ChlNC64A_1_7300
UniProt: E1Z248
Position
Unknown
AA seq 590 aa AA seqDB search
AKQLVVLYASQTGTAQEIAKNIQAEAEQRGIQGRVASMNEFGFDSLTAAHPPVLIYVASS
TGDGDAPDNSAKFYATLRRKSQPGGLLAGIAFTGFGLGDSNYTRYQYVPRAIKQRLLDLG
AAQFYPVGEADEVDGIEEGVDKWLEGLWPALRKAVQPEGAAEMAGVPPLPRCRVRLVWRE
SGDGGAAAARPSEAGAPGGAELAYRDPDGQYSLEQPFWAPVLHLELDIAGSGMRYAPGDS
VGVLPRNDPALVEALLRRLELDGEAVFDQQTGGGEHLLPHLRAPCSVRAALTGGVDLTGP
PRKSLLRLLAEHCGEAGERAALLRLCSRDGRDDYGRQMVAGRPSLLQLLRQFPSCRPPLD
ALLDALPPLAPRMYSLSCSPLECPDKVQVAFTVVRYSTEQYGQHQGVATTWLHGLCEAIA
AGAQPAAAAALRLPIFLRRGGAFGPPDSLETPLIMIGPGTGVTPFRGFLQHRRAQVAAAA
AGGCVAGGTSSTKGPAWLYFGCRREDQDYLYREDLEGFQADGTLDRLHVAFSRAQAHKVY
VQHLMQQHAAELHDMIARQGARVYLCGDGAGMARDVHACLASILQQQGGL
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
gccaagcagctggttgtgctgtacgcctcccagaccggtaccgcccaggagattgccaag
aacatccaggcggaggcagagcagcgggggatccagggcagggtggcctccatgaatgaa
tttgggtttgacagcctcaccgcggcacacccccctgtgctgatctacgtggcaagctcc
accggcgacggggacgccccagacaactccgccaagttctacgccaccctgcgccgcaag
tcccagcccggcggcctgctggccggcatcgccttcaccggctttgggctgggcgacagt
aactacacgcgctaccagtatgtgcctcgcgccattaagcagcgcctgctggacctgggg
gctgcgcagttctatcccgtgggagaggcagatgaggttgacggcattgaggagggggta
gacaagtggttggaggggctgtggcctgcgctgcgcaaggcggtgcagcccgaaggcgcc
gccgagatggcgggcgtgccgccgctgccgcgctgccgcgtgcggctggtgtggcgtgag
agcggggacggcggcgcggcagcggcgcgtccctccgaggcgggcgcgccaggtggcgcc
gagctggcgtaccgcgacccagacgggcagtacagcttggagcagcccttctgggccccc
gtgctgcacttggagctggacatcgccggcagcggcatgcgctacgcgccgggcgactct
gtgggcgtgctgccccggaacgacccggcgctggtggaggcgctgctgcggcggctggag
ctggacggggaggcggtgtttgatcagcagacgggcggcggggagcacctgctgccgcac
ctgcgcgccccctgcagcgtgcgcgccgcgctgaccggcggcgtggacctcaccggtccg
ccccgcaagtcgctgctgcgcctgctggccgagcactgcggcgaggcgggggagcgcgcc
gcgctgctgcgtctctgctcccgcgacggccgcgacgactacggccgccagatggtggca
gggcggccctcgctgctgcagctgctgcgacagttcccctcctgccggccgccgctggac
gcgctgctcgatgcgctgccgccgctggcgccccgcatgtactctctgagctgctcaccc
ctcgagtgcccagacaaggtgcaagttgccttcactgtggtgcggtacagtaccgagcag
tacggccagcaccagggcgtggctaccacctggcttcacgggctgtgcgaggccatcgca
gccggcgcccagcccgcggcagccgccgccctgcgcctgcccatcttcctgcgccgcggc
ggcgcctttgggccgcctgacagcctggagacgccccttatcatgattgggccgggcacc
ggcgtgaccccctttcgcggcttcctgcagcaccgtcgcgcccaggtggcggctgctgcc
gcagggggctgcgtggccggcggtacgagcagtacaaagggccccgcctggctgtacttc
gggtgccggcgggaggaccaggactacctgtaccgcgaggacctggagggcttccaagcc
gacggcacgctcgaccgcctgcacgtcgccttctcccgcgcccaggcccacaaggtgtac
gtgcagcacctgatgcagcagcacgccgcagagctgcacgacatgatcgccaggcagggc
gcaagggtgtatctgtgcggcgacggcgccggcatggccagagacgtgcacgcctgcctg
gcttccatcctgcagcagcaggggggcctc

DBGET integrated database retrieval system