KEGG   Corynebacterium vitaeruminis: B843_04775Help
Entry
B843_04775        CDS       T03042                                 

Definition
(GenBank) acyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cvt  Corynebacterium vitaeruminis
Pathway
cvt00071  Fatty acid degradation
cvt00072  Synthesis and degradation of ketone bodies
cvt00280  Valine, leucine and isoleucine degradation
cvt00310  Lysine degradation
cvt00362  Benzoate degradation
cvt00380  Tryptophan metabolism
cvt00620  Pyruvate metabolism
cvt00630  Glyoxylate and dicarboxylate metabolism
cvt00640  Propanoate metabolism
cvt00650  Butanoate metabolism
cvt00900  Terpenoid backbone biosynthesis
cvt01100  Metabolic pathways
cvt01110  Biosynthesis of secondary metabolites
cvt01120  Microbial metabolism in diverse environments
cvt01130  Biosynthesis of antibiotics
cvt01200  Carbon metabolism
cvt01212  Fatty acid metabolism
cvt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cvt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B843_04775
   00630 Glyoxylate and dicarboxylate metabolism
    B843_04775
   00640 Propanoate metabolism
    B843_04775
   00650 Butanoate metabolism
    B843_04775
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B843_04775
   00072 Synthesis and degradation of ketone bodies
    B843_04775
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B843_04775
   00310 Lysine degradation
    B843_04775
   00380 Tryptophan metabolism
    B843_04775
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B843_04775
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B843_04775
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B843_04775
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cvt04147]
    B843_04775
Enzymes [BR:cvt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     B843_04775
Exosome [BR:cvt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B843_04775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Cuticle_3
Motif
Other DBs
NCBI-ProteinID: AHI22344
UniProt: W5Y075
Position
1023251..1024435
Genome map
AA seq 394 aa AA seqDB search
MKSPDDVVIVGVARTPFGRLLGSLAGLKATELGGIAIRGALERAGVSGDEVDAVIFGQVL
QAGVGQNPTKQAALAGGVREEAHTLTVNKVCLSGLTAVIDGARLLRSGEATVVVAGGMES
MTNAPHLASVRAGVKFGPATMVDHMEYDGLSSAYDGVSMGALSEDFSELHPVTREEQDQL
SAWSHQRAHATAEAGGFDEEIVPVTIKTRKGEITVTRDEGVRPDATAESLGALRPAFKKE
GTITAGNSSQISDGAAAVVLTTRAHAEQKGLTILAAVRAPGQIAGPDHSLQQKPAQALQV
ALDREGWLASDLDLVEINEAFAAVAVHSARVLGLNTDIVNPQGGAVALGHPIGASGARLA
GHAALQLAAGKASRAGIALCGGGGQGEALLLEAE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctcctgatgacgttgtaatcgtaggtgtcgcgcgcacccccttcggcaggctc
ctgggctcgctcgcggggctcaaggccaccgagctgggcgggatcgccatccgcggggcg
ctcgagcgcgccggggtgtccggcgacgaggtggacgccgtgatcttcggccaggtgctg
caggcgggcgtgggccagaaccccaccaagcaggcggccctggcgggcggcgtgcgcgag
gaggcccacacgctcaccgtcaacaaggtctgcctgtccgggctcacggccgtcatcgat
ggcgcgcgcctgctgcgctccggcgaggccaccgtcgtcgtcgcgggcggcatggagtcc
atgaccaatgccccgcacctggccagcgtgcgcgccggggtgaagttcggccccgccacc
atggtcgaccacatggagtacgacggcctgagcagcgcctacgacggcgtctccatgggc
gcgctcagcgaggacttctccgagctgcacccggtcacgcgcgaggagcaggatcagctg
tccgcctggtcccaccagcgcgcccacgccaccgccgaggccggcggcttcgacgaagag
atcgtcccggtgaccatcaagacccgcaagggcgagatcaccgtcacccgcgacgagggc
gtgcgccccgacgccaccgccgagagccttggcgccctgcgcccggccttcaagaaggag
ggcacgatcaccgccggaaactcctcgcagatctccgacggcgccgccgccgtcgtgctc
accacccgcgcccacgcggagcagaaggggctgaccatcctcgccgccgtgcgcgcgccg
ggccagatcgcgggccccgaccactccctgcagcaaaagcccgcgcaggccctgcaggtc
gccctcgaccgcgagggctggctggcctccgacctcgacctcgtcgagatcaacgaggcc
ttcgccgccgtggccgtgcactcggcgcgggtgctggggctcaataccgacatcgtcaac
ccccagggcggcgccgtggcgctcggccacccgatcggcgcctccggtgcccgcctggcg
ggtcacgcggcgctccagcttgccgccgggaaggcctcccgcgccgggatcgccctgtgt
ggcggcggcggccagggcgaggcgctcctgctcgaggccgagtaa

DBGET integrated database retrieval system