KEGG   Corynebacterium vitaeruminis: B843_09760Help
Entry
B843_09760        CDS       T03042                                 

Definition
(GenBank) acid phosphatase
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
cvt  Corynebacterium vitaeruminis
Pathway
cvt00562  Inositol phosphate metabolism
cvt00564  Glycerophospholipid metabolism
cvt01100  Metabolic pathways
cvt01110  Biosynthesis of secondary metabolites
cvt02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cvt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    B843_09760
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    B843_09760
   00565 Ether lipid metabolism
    B843_09760
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    B843_09760
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:cvt02042]
    B843_09760
Enzymes [BR:cvt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     B843_09760
Bacterial toxins [BR:cvt02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   B843_09760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase
Motif
Other DBs
NCBI-ProteinID: AHI23337
UniProt: W5Y296
Position
complement(2172012..2173940)
Genome map
AA seq 642 aa AA seqDB search
MSSHSPSRKGLSLCAAAATCAASMLAGAGAASAEDSTATPIKHVVVIYSENISFDHYFAT
YPNAANTAGETMQGSNAPAPSFTAKADTPKVNNLETANLLGDANPNSVKPFRLTPGQAAT
TDQNHEYSAEQEAANNGAMDKFPETVSTDVDKSSNGYFAAPGLTMGYYDGNTVTGMWNYS
QNFSMNDNSFSTIFGPSTPGALNLVAGTVANATMHDPATGEQATIEPGKSSALAGVPADG
KTATVVGDPDPLYDDCSNASSASTNKVAALSDKNIGDQMNENGVTWGWFQGGFRPTEQAT
DSSRARCGSAHKTLTGQTQADYNPHHEPFQYYASTANPHHLAPSSDSMIGQTDQANHQYD
LSDFDTALKNGNLPAVSFLKAANYQDGHAGYSNPYDEQAFMTHYINELQNSKEWDSTAVI
IAYDDSDGWYDHQAPKILNGSNDTTIDEETGSPVDAEICTSAAQSVGVAGGSNGQCGPGT
RQPLLVISPYSKVNYVDSTYTEQTSITKFIQDNWNLGRLGGNSFDDRAGVLNNMFDFAAG
ATAPKVFLNETDGTVASSYEEVKKVDDSSRATTGLKSVADGMNDPTVTEQGTSPQVMLSA
SSQAETSGSSSKGLWAGVGIGVVVVLGVIAWLASRRKSSSAK
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcccattccccctcccgtaagggactctcgctgtgcgcggcggccgccacctgc
gcggcgtcgatgctcgccggagccggtgctgcctcggccgaggattccaccgcaacacct
atcaagcacgtggtcgtcatctactcggagaacatctccttcgaccactacttcgccacc
taccccaacgcggccaacactgcgggagagaccatgcagggaagcaacgcccccgcgccg
agtttcaccgcgaaggccgacaccccgaaggtgaataacctggaaaccgccaacctgctc
ggagacgcgaacccgaactcggtcaagcccttccgcctcaccccgggccaggccgccacc
acggaccagaaccacgagtactccgccgagcaggaggccgccaacaacggcgcgatggac
aagttccccgagaccgtgtccaccgacgtggacaagtcttccaacggctactttgcggca
ccggggctgacgatgggctactacgacggaaacaccgtgacggggatgtggaactactcg
cagaacttctcgatgaacgacaacagcttctcgacgatcttcgggccatccacccccggc
gcgctcaacctcgtcgccggaaccgtcgccaacgccaccatgcacgatccggccaccggc
gagcaagcgactattgagccggggaagtcatccgccctcgcgggggtgcctgccgacggg
aagaccgccaccgtggtcggtgaccccgatccgctctacgacgactgctccaacgcttcg
tccgcgtccaccaacaaggtggcggcgctgagcgacaagaacatcggcgaccagatgaac
gaaaacggtgtgacctggggatggttccagggcggattccgaccgacggagcaggccacc
gactcctcccgcgcgcgctgcggctcggcgcacaagacgctcaccgggcagacccaggcc
gattacaacccgcaccacgagccgttccagtattacgcttctacagccaacccgcaccat
ctcgcgccgagcagcgactctatgatcggccagacggatcaggcgaaccaccagtacgac
ctctcggacttcgataccgccctgaagaatggaaacctccccgcggtgagcttcctcaag
gctgccaattaccaggacggccacgccggctattcgaacccctatgacgagcaggccttc
atgacccactacatcaacgagcttcagaactcgaaggagtgggactccaccgccgttatc
atcgcctacgacgactccgacggatggtacgaccaccaagcgccgaagatcctcaacgga
tccaacgacaccacgatcgatgaggagaccggctcgccggtcgacgcggaaatctgcacc
tcggcggcgcagagcgtgggggtcgcgggcggctcaaacggccagtgcggcccgggcacc
cgccagccgctcctggtgatctcgccgtactccaaggtcaactacgtcgacagcacctac
acggagcagacctccatcaccaagttcatccaggacaactggaacctgggccgcctcggc
ggcaactccttcgacgaccgcgccggggtcctcaacaacatgttcgatttcgcggcgggc
gctaccgcaccgaaggtgttcctcaacgagaccgacggaacggttgcttcctcctacgag
gaagtcaagaaggtcgatgattcctcccgcgcgacgacgggactaaagagcgtcgccgac
ggcatgaacgaccccaccgtgacggaacaggggacctccccgcaggtcatgctcagcgcg
agcagccaggctgaaacctccggctcctccagcaagggtctgtgggcaggcgtcggcatc
ggcgtcgtggtggttctcggggtcatcgcgtggttggcaagccggaggaagagcagctcc
gccaagtag

DBGET integrated database retrieval system