KEGG   Crocosphaera watsonii: CwatDRAFT_2716Help
Entry
CwatDRAFT_2716    CDS       T05097                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
cwa  Crocosphaera watsonii
Pathway
cwa00630  Glyoxylate and dicarboxylate metabolism
cwa00710  Carbon fixation in photosynthetic organisms
cwa01100  Metabolic pathways
cwa01110  Biosynthesis of secondary metabolites
cwa01120  Microbial metabolism in diverse environments
cwa01130  Biosynthesis of antibiotics
cwa01200  Carbon metabolism
Module
cwa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
cwa_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
cwa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cwa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CwatDRAFT_2716
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CwatDRAFT_2716
Enzymes [BR:cwa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     CwatDRAFT_2716
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: EAM50083
UniProt: Q4C1Q9
Position
14380..14715
AA seq 111 aa AA seqDB search
MKTLPKERRYETLSYLPPLTDQQILLQVQNVLDQGMIPGVEFEEDPSPTTHFWTMWKLPL
FNAVSAQEVLAEVRECRSEYPNAYIRVIGFDNIKQCQTMSFIVHKPNNRAY
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattacccaaagagcgtcgttacgaaaccctttcttatttaccccctttaacc
gaccaacaaattctgctccaagttcagaatgtcttggatcaagggatgattcctggggtt
gagtttgaagaagatcccagcccaaccactcacttctggacaatgtggaagttacctttg
tttaatgctgtttctgctcaagaagtgttagctgaagtacgggaatgtcgttctgagtat
cctaacgcttatattcgtgtaattggtttcgacaacatcaaacagtgtcaaaccatgagt
ttcatcgttcataagcccaacaaccgtgcatactaa

DBGET integrated database retrieval system