KEGG   Crocosphaera watsonii: CwatDRAFT_3533Help
Entry
CwatDRAFT_3533    CDS       T05097                                 

Definition
(GenBank) 6-phosphogluconate dehydrogenase, decarboxylating
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
cwa  Crocosphaera watsonii
Pathway
cwa00030  Pentose phosphate pathway
cwa00480  Glutathione metabolism
cwa01100  Metabolic pathways
cwa01110  Biosynthesis of secondary metabolites
cwa01120  Microbial metabolism in diverse environments
cwa01130  Biosynthesis of antibiotics
cwa01200  Carbon metabolism
Module
cwa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
cwa_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:cwa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CwatDRAFT_3533
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CwatDRAFT_3533
Enzymes [BR:cwa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     CwatDRAFT_3533
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     CwatDRAFT_3533
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 6PGD NAD_binding_2 2-Hacid_dh_C 3HCDH_N NAD_binding_11 Shikimate_DH PGK
Motif
Other DBs
NCBI-ProteinID: EAM50577
UniProt: Q4C346
Position
24900..26321
AA seq 473 aa AA seqDB search
MTKRTFGVIGLAVMGENLALNVESRGFPIAVYNRTASKTEEFMKTRAQGKDVKAAYSLEE
FVKTLERPRKILVMVKAGAPVDYVIEDLKPLLEEGDMIIDGGNSLYEDTERRTRDLESTG
LGFVGMGVSGGEEGALKGPSLMPGGTKAAYEELEPILTKIAAQVDDGPCVTFVGPGGAGH
YVKMVHNGIEYGDMQLIAEAYDIMKNALGLSNEELHEVFKEWNTTDELNSFLIEITADIF
KYVDPDSKKHLVDLILDSAGQKGTGRWTVVSSLELGVPIPTMYAAVNARVMSSYKEERES
ASHQLTGPAIKFDGDKKAFINKVRDALYCSKMCSYAQGMALIAKASAEYYGNQVSLPESA
RIWKGGCIIRAGFLDKIKKAFVDNPDLPNLLLAPEFKQSILDRQEAWREVLVLANQVGIP
VPAFSASLDYFDSYRRADLPQNLTQAQRDYFGAHTYERVDKPKGEAFHTEWAA
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagcgaacctttggtgtcatcggcctggcggtaatgggagaaaatctcgccctt
aatgtcgaaagtcgcggctttcccattgctgtatataaccgtacagccagtaaaacagaa
gaattcatgaaaacacgggcccaaggcaaagatgtcaaagcggcctattcattagaagaa
tttgtaaaaaccttagaacgtcctcgtaaaatcttagtcatggttaaagcaggtgcgcct
gttgactatgtgatcgaagatttgaaacccctcttagaagaaggggatatgattatcgat
ggcggtaactccttatacgaagataccgaaagacgcacgagagacctagaatcaactggt
cttggtttcgtcggaatgggtgttagtggcggtgaagaaggtgccttaaaaggtcctagc
ttaatgcctggcggtaccaaagcagcctacgaagaattagaacccatcttaaccaaaatt
gctgcacaggtagatgatggtccctgtgttacctttgttggccctggtggtgccggacac
tatgtgaaaatggttcacaacggcattgagtacggcgatatgcagttaattgcagaagcc
tacgacatcatgaaaaatgctcttggcctgagcaacgaagaattacacgaagtattcaaa
gagtggaataccaccgatgaacttaattctttcttaattgaaattacggctgatatcttc
aagtatgttgaccccgatagcaagaagcatctggttgacctaattttagactctgctgga
caaaaaggaaccggtcgctggaccgtagtaagttccttagagttaggagttcccatcccc
accatgtacgctgcggtgaatgcgcgggtgatgtcttcctacaaggaagaaagagagtct
gcttctcaccagttaactggccctgccattaaatttgatggagacaaaaaagccttcatc
aacaaggttagagacgctctctactgctctaaaatgtgttcctatgctcaaggaatggct
ttaattgctaaagcttctgctgagtattatggtaaccaggttagcttacccgaatctgcc
cgtatctggaaaggcggttgtattattcgtgccggtttcttagacaagattaagaaggca
tttgtagataatcctgatctacctaacctactcttagcccctgagtttaaacaaagtatc
ttagatcgtcaagaagcttggcgtgaagtgctagtattagccaatcaagtaggtattcct
gttcctgcttttagtgcttctttagactacttcgatagctatcgtcgtgctgatctacct
cagaacttaacccaggcacaaagagactactttggtgcgcacacttatgagcgtgttgat
aagcccaaaggagaagctttccacaccgagtgggccgcttaa

DBGET integrated database retrieval system