KEGG   Crocosphaera watsonii: CwatDRAFT_6188Help
Entry
CwatDRAFT_6188    CDS       T05097                                 

Definition
(GenBank) Nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
cwa  Crocosphaera watsonii
Pathway
cwa00230  Purine metabolism
cwa00240  Pyrimidine metabolism
cwa01100  Metabolic pathways
cwa01110  Biosynthesis of secondary metabolites
cwa01130  Biosynthesis of antibiotics
Module
cwa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
cwa_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
cwa_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:cwa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CwatDRAFT_6188
   00240 Pyrimidine metabolism
    CwatDRAFT_6188
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cwa04131]
    CwatDRAFT_6188
Enzymes [BR:cwa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     CwatDRAFT_6188
Membrane trafficking [BR:cwa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    CwatDRAFT_6188
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: EAM53040
UniProt: Q4CA96
Position
324072..324521
AA seq 149 aa AA seqDB search
MERTFIMIKPDGVQRGLVGEIIGRFEAKGFTLVGLKSLSVSRELAEEHYDVHKERPFFGG
LVDFICSSPVVAMVWEGDGVVASARKLIGATNPLSAEPGTIRGDFGVSVGLNLIHGSDAI
ETAQKEINLWFSEKELLSWEPTVNAWLYE
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
gtggaacgtacatttatcatgattaagcccgacggggtacaacggggactggtaggggaa
attattggtcgttttgaggctaaagggtttaccctagtgggactaaaatcactgtcagtg
tctagagaattagccgaagaacactacgatgtccataaagaacgtcctttctttggtggt
ttagtcgattttatttgttcttctcctgttgtggctatggtatgggaaggagatggagtc
gtggcttccgcaaggaaattgatcggcgcaactaaccccctatctgccgaaccgggaaca
attcggggtgattttggcgttagtgtagggctgaacctgattcatggttctgatgctatc
gaaaccgctcaaaaagagattaatctctggttcagcgaaaaagaattactctcttgggaa
cccaccgttaacgcctggttatacgaataa

DBGET integrated database retrieval system