KEGG   Crocosphaera watsonii: CwatDRAFT_6707Help
Entry
CwatDRAFT_6707    CDS       T05097                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cwa  Crocosphaera watsonii
Pathway
cwa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cwa01100  Metabolic pathways
cwa01110  Biosynthesis of secondary metabolites
cwa01130  Biosynthesis of antibiotics
cwa01230  Biosynthesis of amino acids
Module
cwa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cwa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CwatDRAFT_6707
Enzymes [BR:cwa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CwatDRAFT_6707
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IGPS ThiG NanE FMN_dh His_biosynth IMPDH
Motif
Other DBs
NCBI-ProteinID: EAM52816
UniProt: Q4CAX0
Position
complement(103232..104119)
AA seq 295 aa AA seqDB search
MQIRRRPPNPAIEVDILRYQVPDPNGEANHILEEIVWHKEKEVERMRESLSLLELRKQER
NAPPAKDFLGAISQGKTQPALIAEVKKASPSKGVIRKDFDPVAIAQAYVKGGASCLSVLT
DSKFFQGSFDNLALVRQAVDIPLLCKEFIIYPYQIYLARVKGADAILLIAAILKDSDLQY
FIKIILSLGMTPLVEVHSLHEMDRVLAIEGVSLLGINNRNLETFEVSLDTTKELLTARQD
QIKEKGIYIVSESGIHSPQDLQQVKQAGANAVLIGESLVKQADPSQVIVKLFSES
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatcagacgacgaccccccaacccagccatagaagtcgatatcttacgttatcaa
gtgcctgatcccaatggtgaggctaaccatatcctcgaagaaatcgtctggcacaaggaa
aaagaagtggaacgaatgcgggaaagtctctccttgttagagttacggaaacaggagaga
aacgcgccaccagctaaagattttttaggggctattagccaaggaaaaacccaacccgct
ttaattgcagaggtaaaaaaagcctctccttctaagggggtgattcgaaaagactttgat
ccggtggccatcgcccaagcttatgttaaaggtggggccagttgtctttctgtgttaacg
gatagtaaattttttcaaggtagttttgataacctggctttagttcgtcaagcagttgat
attcctttgctatgtaaggaatttattatttatccctatcaaatctatttagctagggtc
aaaggggccgatgctattcttttaattgctgctattctgaaagattcagatttacagtat
tttattaaaattattctttccttgggtatgactcctttagtagaggttcattctttgcat
gaaatggatcgggttttggctattgagggggtttctttactgggaattaataaccgtaac
ctcgaaacctttgaggtgagtttagacacaactaaagaattattaactgcccgtcaagat
cagatcaaagagaaaggcatttatattgtcagtgaatccggtattcatagcccccaagac
ttacaacaggtcaaacaagcaggagctaacgctgttttgattggagaatctctagttaaa
caagcagatccttcccaggtgatcgttaaattattttctgagagttaa

DBGET integrated database retrieval system