KEGG   Citrobacter werkmanii: CO701_00840Help
Entry
CO701_00840       CDS       T05129                                 

Definition
(GenBank) 2-dehydro-3-deoxyglucarate aldolase
  KO
K01630  2-dehydro-3-deoxyglucarate aldolase [EC:4.1.2.20]
Organism
cwe  Citrobacter werkmanii
Pathway
cwe00053  Ascorbate and aldarate metabolism
cwe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cwe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    CO701_00840
Enzymes [BR:cwe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.20  2-dehydro-3-deoxyglucarate aldolase
     CO701_00840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpcH_HpaI PK
Motif
Other DBs
NCBI-ProteinID: ATF47800
Position
160669..161439
Genome map
AA seq 256 aa AA seqDB search
MNNTIFPNKFKAALAAHQVQIGCWSALASPISTEVLGLAGFDWLVLDGEHAPNDISTFIP
QLMALKGSSSAPVVRVPTNEPVIIKRLLDIGFYNFLIPFVETEEDAVNAVASTRYPPEGI
RGVSVSHRANMFGTVPYYFAQSNKNITIIVQIESQQGVDNVDAIAATEGVDGIFVGPSDL
AAALGHLGNASHPEVQKAIQHIFAVAKKHGKPSGILAPVDADARRYLDWGATFVAVGSDL
GVFRSATQKLADSFKK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaataacacgattttcccaaacaaatttaaagcggcacttgcggcgcatcaggttcag
attggctgctggtccgcgctggcaagcccgatcagtaccgaagtattaggcctggccggt
tttgactggctggtgctggacggtgaacatgcgccaaacgatatctcgacgtttatccca
cagctgatggcgctgaaaggcagttccagcgcgccagttgtgcgtgtgccgaccaacgag
ccggtgatcatcaagcgtttgctggatattggtttctataacttcctgattccgtttgtt
gagaccgaagaagatgcggtgaacgccgtggcgtctacccgctatccgccggaaggtatt
cgcggcgtatcggtttctcaccgcgccaatatgtttggcaccgtgccgtactacttcgca
cagtcaaataaaaacatcaccatcatcgtgcagatcgaaagtcagcagggtgttgataac
gtggatgcgattgccgcaaccgaaggcgtggacggtattttcgtcggcccaagcgacctg
gccgccgcgttaggccacctgggcaatgcctcccatccggaagtgcaaaaggcgattcag
cacatctttgcggtcgcgaaaaagcacggtaagccaagcggcattctggcaccggttgat
gcagatgcccgtcgctacctggactggggcgcgacgtttgttgccgtcggtagcgatctc
ggcgtgttccgttcagcgacgcaaaaactggctgattcttttaagaaataa

DBGET integrated database retrieval system