KEGG   Citrobacter werkmanii: CO701_02230Help
Entry
CO701_02230       CDS       T05129                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
cwe  Citrobacter werkmanii
Pathway
cwe00052  Galactose metabolism
cwe00500  Starch and sucrose metabolism
cwe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cwe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CO701_02230
   00500 Starch and sucrose metabolism
    CO701_02230
Enzymes [BR:cwe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     CO701_02230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: ATF48040
UniProt: A0A291CV29
Position
434585..435985
Genome map
AA seq 466 aa AA seqDB search
MSHPSRLPAILQAVMQGQPRALTDSHYPRWHHAPVTGLMNDPNGFIEFAGRYHLFYQWNP
LACDHKFKCWGHWSSADLLHWQHEPIALMPDEEYDRNGCYSGSAVDSQGTLTLCYTGNVK
FDDGSRTAWQCLATENADGTFTKLGPVLPLPEGYTGHVRDPKVWQHEGRWYMVLGAQDLQ
KRGKVLLFSSADLHEWTSQGEIAGYGINGLDDAGYMWECPDLFALGDQHVLICCPQGVPR
EKERYLNTYPAVWMSGDFDYHRAAFEHGELHELDAGFEFYAPQTMLTSDGRRLLVGWMGV
PEGEEMLQPTLTNGWIHQMTCLRELEFIDGQLYQRPLRELSALRGEAHGWAGNSLPLAPM
EIVLQTTGDDILSLDFDGALTLERDASGICLARPSLASDEKHYRYWRGDVRSLHIFIDQS
SVEIFINGGEGVMSCRYFPACSGQLMFSGITPDAFCYWPLRTCMVE
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtcacatccatcacgcctgcctgcgattttgcaggctgttatgcagggccagccgcgc
gcgctgaccgacagccactatccccgctggcaccatgcgccggtgaccgggctgatgaac
gatcccaacggctttattgaatttgccggacgttatcacctgttttatcagtggaacccg
ctcgcctgcgatcataagttcaagtgctgggggcactggagctctgccgacctgctgcac
tggcaacatgagccgatcgcgctcatgccggatgaagagtatgaccgcaacggctgctac
tccggcagcgccgtggatagtcagggcacgctcaccctgtgctataccggcaacgtaaaa
tttgacgacggcagccgaaccgcgtggcagtgcctggcgacggaaaatgccgacggcacg
tttaccaaactcggcccggtattaccgctgccggagggctataccggccacgtgcgtgac
ccgaaagtctggcagcacgaaggtcgctggtacatggtgctgggcgcacaggatttgcaa
aagcgtggcaaggtgttgttattcagctcagcggaccttcatgagtggacgagtcagggc
gaaatcgccggttatggcatcaatggcctggacgacgcgggctatatgtgggaatgcccg
gacctgtttgccctcggcgaccagcatgtcctgatttgctgcccgcagggcgtgcctcgt
gagaaagagcgctatctcaacacctacccggcagtgtggatgagcggcgatttcgactac
caccgcgcggccttcgagcatggcgaactgcacgaattggacgcagggtttgagttctac
gccccgcaaaccatgcttaccagtgatggccgccgtctgctggtcggctggatgggcgtg
ccggagggcgaagagatgcttcaaccgaccctcaccaacggctggatccatcagatgacc
tgcctgcgtgagctggagtttatcgatggtcagctataccaacgtcctctacgagagctg
agcgccctgcgcggcgaagcgcacggctgggcagggaactccctgccgctggcaccgatg
gaaatcgttctacaaaccactggggacgatattttgagcctcgattttgacggcgcatta
acccttgaacgcgatgccagcgggatctgcctggcccgacccagtctggccagcgacgag
aagcattatcgttactggcgcggagacgtccgctcgctgcatattttcatcgaccagtct
agcgtggagattttcatcaacggcggcgaaggagtgatgagctgccgctacttcccggcc
tgttcagggcagctaatgttctccggcatcacaccggacgcattctgctactggccgctg
cgaacttgcatggtagaataa

DBGET integrated database retrieval system