KEGG   Citrobacter werkmanii: CO701_03445Help
Entry
CO701_03445       CDS       T05129                                 

Definition
(GenBank) tRNA pseudouridine(65) synthase TruC
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
cwe  Citrobacter werkmanii
Brite
KEGG Orthology (KO) [BR:cwe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cwe03016]
    CO701_03445
Enzymes [BR:cwe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     CO701_03445
Transfer RNA biogenesis [BR:cwe03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    CO701_03445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ATF48264
Position
685977..686759
Genome map
AA seq 260 aa AA seqDB search
MLEILYQDEWLVAVNKPSGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTVHRLDRPTSGV
LLMGLSSEAGRLLSQQFEQHQIQKRYHAIVRGWLMDDAVLDYPLVEELDKIADKFSREDK
DPQPAVTHYRGLATVEMPVATGRYPTTRYGLVELEPKTGRKHQLRRHLSHLRHPIIGDSK
HGDLRQNRSAAEHFGCQRLMLHASQLTLTHPFTGEPLVIRAGLDDVWMQALSQFGWRGLL
PENERVEFSERSGQDEQIDS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcttgagatcctctatcaggacgaatggctggttgctgttaacaaaccttctggttgg
ttggttcaccgcagctggctcgaccgcgatgagaaagtggtcgtgatgcaaacggtgcgt
gaccagattggtcagcatgtttttaccgtgcatcgcctcgaccgaccgacatccggcgtg
ctgctgatgggattgtccagcgaagccgggcgtttgctgtcgcagcagtttgaacagcat
caaattcaaaagcgttatcatgccattgtgcgtggctggctaatggatgacgcggtgctg
gattacccgctggtggaagagttggataaaattgccgacaaattttcccgtgaagataaa
gatccgcaaccggcggtcacccactatcgcggactggcaacggtagaaatgccggtggcc
accgggcgttatccaacgactcgctacggactggtagagcttgagcctaaaaccggtcgt
aaacaccagctccggcggcatctgtcccatttacgccatcctattattggcgacagtaag
cacggtgatttgcggcagaaccgcagtgcggcggagcatttcggttgccagcgcttaatg
ttgcatgccagccagcttacgcttacccatccgttcactggcgagccattggtgattcgc
gcgggtctggatgacgtctggatgcaggcgctatcgcagtttggctggcgtggacttctc
cctgagaatgaaagggttgagttcagcgagcggtcaggtcaggatgagcaaatagattct
taa

DBGET integrated database retrieval system