KEGG   Citrobacter werkmanii: CO701_10585Help
Entry
CO701_10585       CDS       T05129                                 

Definition
(GenBank) succinate-semialdehyde dehydrogenase
  KO
K08324  succinate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.24]
Organism
cwe  Citrobacter werkmanii
Pathway
cwe00250  Alanine, aspartate and glutamate metabolism
cwe00650  Butanoate metabolism
cwe00760  Nicotinate and nicotinamide metabolism
cwe01100  Metabolic pathways
cwe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cwe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CO701_10585
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CO701_10585
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CO701_10585
Enzymes [BR:cwe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     CO701_10585
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     CO701_10585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ATF49542
Position
complement(2129422..2130810)
Genome map
AA seq 462 aa AA seqDB search
MTITSATHAISVNPVNGERLTAMPWASRDEIAHALDLAASGFNEWKHTTVAHRAQMLRKV
GHALRQRAEEMAQCISREMGKPIKQARAEVAKSAALCDWYAEHGPLMLNPEPTQVENNQA
VIEYRPLGTILAVMPWNFPLWQVMRGAVPILLAGNGYLLKHAPNVTGCAGIIAQAFADAG
IPQGVYGWVNADNSGVSQIINDPRIAAVTVTGSVRAGAAIGAQAGAALKKCVLELGGSDP
FIVLNDADLDLAVKAAVAGRYQNTGQVCAAAKRFIVEEGIAAEFTQRFVAAASALKMGDP
LNEENDLGPMARVDLRDELHQQVEASLAQGATLLLGGEKIAGKGNYYTITVLGDVTPEMT
AFRQELFGPVAAITVAKNAEHALVLANESDFGLSATIFTADETLAQNMAARLECGGVFIN
GYSASDARVAFGGVKKSGFGRELSHFGLHEFCNVQTVWKNRI
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcacatcagcaacacatgcgatttccgtcaatcctgtgaacggcgaaaggtta
acggcgatgccgtgggctagtcgggatgagattgcccatgcgcttgatctggccgccagt
ggatttaatgaatggaaacacaccaccgtggcgcatcgggcgcagatgctgcgcaaggtt
gggcacgctctgcgccagcgtgcggaagagatggcacagtgtatctcacgggaaatgggg
aaaccgataaaacaggctcgtgcagaagtggcgaaatccgcggcgctgtgtgactggtat
gcagagcatggacctttgatgcttaatcctgaaccaacacaggtggagaataaccaggcg
gtgatcgaatatcgtcctctgggcactattctggctgttatgccgtggaacttcccgctg
tggcaggtcatgcgcggtgcagtgcctattttattggccgggaatggttacctgttaaag
catgcaccgaatgtaaccgggtgtgccggtattattgcgcaggcgtttgctgatgccggt
atcccgcagggggtatatggctgggtgaatgccgataactcgggcgttagccagataatc
aacgatccgcgtattgccgccgttacggtaacgggaagtgtgcgagccggggcggcaatt
ggtgctcaggcgggggcggcgctgaagaaatgcgtgcttgaactgggtggatccgatccg
ttcattgtccttaacgatgctgacctcgatctggccgtgaaggcggcagtcgccggtcgt
tatcagaataccgggcaggtttgtgcggcagcgaaacgttttattgttgaggaagggatt
gcggcagaatttactcagcgttttgtggcggcggccagtgcgctaaaaatgggcgatcct
ctgaatgaggaaaacgatctcggcccaatggcacgcgttgatctgcgtgatgaactgcat
cagcaagttgaggcttcgctggctcaaggggcgacgttgttactcggtggcgaaaaaatt
gccggaaaaggtaactactataccatcacggttcttggtgacgtgacacctgagatgacc
gctttccgccaggaattgttcggcccggtagcagcaattaccgtagcgaagaacgcagag
catgcgttagtactggcgaatgagagtgattttggcttgtcggcaacgattttcaccgct
gatgagacactggcgcagaatatggctgcacgcctggaatgtggcggggtatttatcaat
ggttatagtgccagtgatgcccgcgttgcgtttggcggggtgaagaaaagcggctttggt
cgggagctttcgcactttggcctgcatgagttttgtaacgtgcagaccgtctggaaaaac
cgtatctaa

DBGET integrated database retrieval system