KEGG   Citrobacter werkmanii: CO701_16820Help
Entry
CO701_16820       CDS       T05129                                 

Gene name
adrA
Definition
(GenBank) diguanylate cyclase AdrA
  KO
K18968  diguanylate cyclase [EC:2.7.7.65]
Organism
cwe  Citrobacter werkmanii
Brite
KEGG Orthology (KO) [BR:cwe00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cwe02000]
    CO701_16820 (adrA)
Enzymes [BR:cwe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     CO701_16820 (adrA)
Transporters [BR:cwe02000]
 Other Transporters
  Others
   CO701_16820 (adrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GGDEF MASE2 DUF3119
Motif
Other DBs
NCBI-ProteinID: ATF50660
Position
complement(3346287..3347402)
Genome map
AA seq 371 aa AA seqDB search
MFLNTMNDESFYQKKVVPNEAVLSLHQNDHQRSGLRFARRIRLPRAVGLGGMFFPIASVL
VSQPITGGWWLLLVGWAFVWPHLAWQLAGKADDPMHSEFTNLKADAILTGMWIGLMGGNL
LPSTALLMIICINLMGAGGIRLFIAGLVLTIVSCLVTLQLTDIPVVFSSTQLSVMLSLPV
LVLYPLLFAWVSYKTVIKLAEHKRRLQVMSTRDGMTGVYNRRHWELLLRNEFDNCRRYQR
DATLLIIDIDHFKSINDTWGHDVGDEAIVALTRQLQMTLRGSDVIGRFGGDEFAVIMCGT
PASSAIAAMSRVHERLSLLRLSCAPQVALRISVGVAPLTSETEHYREWLKSADMALYKAK
NSGRNRTEAAA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgttcctaaatacgatgaatgatgaaagtttctatcaaaaaaaggtcgtcccaaatgaa
gcggttttatcgcttcatcaaaatgaccatcagcgctccggactgcgatttgcccgacgg
atcaggctgccgcgcgcggtgggactgggcgggatgtttttccctatcgcgtcggtcctg
gtgtctcagccgatcaccggaggctggtggcttttactggtaggatgggcttttgtctgg
ccgcatctggcatggcagttggcgggcaaagcagatgacccgatgcatagcgaattcacc
aacttaaaagccgatgcgattctgaccggaatgtggatagggctgatggggggaaatctg
ctaccgtcgacggccctactgatgattatctgtatcaacctgatgggcgcagggggaata
cggttattcatcgccggtctggtgttgacgattgtctcatgtctggtcaccctgcaactg
acggacatccccgtggtgtttagcagtacgcaactgagtgtgatgctgtcgctaccggtg
ttggtgttgtatccgctgctgtttgcgtgggtgagctataagacggtcatcaaactggct
gagcacaaacgtcggttgcaggtgatgagcacgcgagatggtatgaccggtgtgtataac
cgacgtcattgggagcttttgctgcgcaatgaatttgataactgccgccgttatcagcgc
gacgccacgttactgattatcgatatcgaccacttcaaaagtattaacgatacctggggc
catgacgttggcgatgaggctattgtcgcgctaacgcgtcagttgcagatgacgctgcgc
ggcagcgatgtcatagggcgttttggtggcgatgaatttgctgtgattatgtgcggtacc
ccggcgagcagcgccatcgccgccatgtctcgtgtccacgaacgactcagcctattgcga
ttgtcctgtgctccgcaggttgctctgcgtatcagcgtcggcgtcgcaccgctgacttca
gaaacggaacactatcgagaatggttgaaatcggcggatatggcgctttataaagcaaag
aattccggacgtaaccgcactgaagcggcggcctga

DBGET integrated database retrieval system