KEGG   Citrobacter werkmanii: CO701_18150Help
Entry
CO701_18150       CDS       T05129                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
cwe  Citrobacter werkmanii
Brite
KEGG Orthology (KO) [BR:cwe00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    CO701_18150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: ATF50900
Position
3655499..3655876
Genome map
AA seq 125 aa AA seqDB search
MINSPRVCIQVQSVYIEAQSSPDDERYVFAYTVTIRNLGRAPVQLLGRYWLITNGHGRET
EVQGEGVVGVQPHIDPGEEYQYTSGAVIETPLGTMQGHYEMIDEKGVAFTIDIPVFRLAV
PTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatcaattcgccccgagtgtgtattcaggtacaaagcgtctatattgaggcgcaatcc
tcacctgatgatgaacgttacgtttttgcctataccgtaaccatccgcaatttggggcga
gcgccggtgcaactgttgggacgttactggttgattaccaatggtcatggccgtgaaacc
gaagttcagggtgaaggtgtggttggcgttcagccccacattgatcccggtgaagagtac
caatataccagcggcgcggtgattgaaaccccgctgggcaccatgcagggtcattacgaa
atgatcgatgagaaaggcgttgcctttaccatcgatattcccgtattcaggctcgccgtt
ccaacgctcatccactaa

DBGET integrated database retrieval system