KEGG   Citrobacter werkmanii: CO701_20625Help
Entry
CO701_20625       CDS       T05129                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
cwe  Citrobacter werkmanii
Pathway
cwe00620  Pyruvate metabolism
cwe00630  Glyoxylate and dicarboxylate metabolism
cwe01100  Metabolic pathways
cwe01110  Biosynthesis of secondary metabolites
cwe01120  Microbial metabolism in diverse environments
cwe01200  Carbon metabolism
Module
cwe_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cwe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CO701_20625
   00630 Glyoxylate and dicarboxylate metabolism
    CO701_20625
Enzymes [BR:cwe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     CO701_20625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ATF51350
Position
complement(4166622..4168223)
Genome map
AA seq 533 aa AA seqDB search
MNQQATTTDELVFTRPHGEQEQQILTAEAVEFLTELVTRFTPKRNKLLAARIQQQQDIDD
GKLPDFISETASIREGSWKIRGIPDDLQDRRVEITGPVERKMVINALNANVRVFMADFED
SLAPEWSKVIDGQINLRDAVNGTISYTNDAGKIYQLKPDPALLVCRVRGLHLPEKHVTWR
EEAIPGSLFDFALYFFHNYKALLAKSSGPYFYLPKTQAWQEAAWWSEVFSYTEDRFNLPR
GTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQV
VTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDAERNNQVLAKVKADKALEANNG
HDGTWVAHPGLADTAMAIFNDVLGNNKNQLFVTREEDAPITAEQLLAPCEGERTEEGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKTLSNGKPVTKPLFR
QMLAEEMRVIQDELGEHRYSSGRFDDAARLMEQITTSDELIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaacaggcaacaacaaccgatgagctggtttttaccaggccgcatggcgagcag
gaacagcagattttgaccgcagaggcggtggaattcctgaccgaattggtgactcgattt
acgccaaaacgcaataaacttctcgccgcgcgtattcagcagcagcaggatattgatgac
ggtaagttgcctgatttcatttcggaaacagcttccattcgtgaaggtagctggaagatt
cgcggtattcctgatgatttacaagatcgtcgcgtggaaatcaccggacccgttgaacgc
aagatggtgattaacgcgctcaacgccaacgttagagtctttatggctgactttgaggat
tcactggctcccgagtggagcaaagtgattgacgggcaaatcaacctgcgcgatgcggtg
aacggtaccatcagttacaccaacgacgctggcaagatataccaactgaagcccgatccg
gcgttattggtttgtcgtgtacgtggcttgcatctgccggaaaaacacgtcacctggcgt
gaggaagcgattcccggcagtctgttcgactttgccctctatttcttccacaactacaaa
gccttgctggctaaaagcagtggtccttacttctatttgccgaaaacgcaggcctggcaa
gaagcggcctggtggagtgaagtcttcagctatacagaagaccgatttaatctgccacgc
ggcacgataaaagccacgttgctgatcgaaacactgccagccgttttccagatggatgag
atcctgcacgcgctgcgtgaccatattgtcggcctcaactgcggtcgttgggattacatt
ttcagctacatcaaaaccctcaagaatcacccggatcgtgttctgcccgatcgtcaggtg
gtaacgatggataagccgttcctcagcgcctactcgcgtctgctgattaaaacctgtcat
aaacgcggtgcctttgcgatgggcggtatggcggcgtttatccccagcaaagacgctgag
cgcaacaatcaggtgctggcaaaagttaaagcggataaagcgctggaagccaataacggt
catgacgggacctgggttgctcaccctggactggcagataccgcaatggcgattttcaac
gacgtgctgggcaacaacaaaaatcagctgtttgtcacccgagaagaggatgcgccgatt
accgcagaacaactgttggctccgtgcgaaggggaacgtactgaagaaggcatgcgcgcc
aatattcgcgttgccgtgcagtacatcgaagcgtggatctctggcaacggttgcgtaccg
atttatggcctgatggaagatgcggcaactgccgaaatctcccgtacctccatctggcag
tggatccaccatcagaaaaccctcagcaacggtaagccggtgaccaaaccgctgttccgt
cagatgctggccgaagaaatgcgggtgattcaggacgagctaggtgaacaccgctacagc
agcgggcgctttgatgacgccgcacgcctgatggagcaaatcaccacctctgacgaactg
atcgacttccttaccttgccaggctaccgcttactggcttaa

DBGET integrated database retrieval system