KEGG   Citrobacter werkmanii: CO701_22530Help
Entry
CO701_22530       CDS       T05129                                 

Definition
(GenBank) D-lyxose/D-mannose family sugar isomerase
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
cwe  Citrobacter werkmanii
Pathway
cwe00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:cwe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CO701_22530
Enzymes [BR:cwe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     CO701_22530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyx_isomer Cupin_2
Motif
Other DBs
NCBI-ProteinID: ATF51678
Position
4565925..4566617
Genome map
AA seq 230 aa AA seqDB search
MKRSQINYAIDKAHAIAETFRLCLPDFAYFTADAWRQQDWAKWREVRDLQLGWDITDFGR
GDFAQTGLTLLTLRNGLLGSANYPKPYAEKMLQIQQDQQTPWHFHTHKMEDIVNRGGGDL
CMQLAWATPDAQYDGQRAVEVNVDGQRRSCKPGDTLVLKPGQGVCLPPRLYHRFWAEKAF
VLGWEISMVNDDQHDNHFLEPGGRFPAITENEPVKWLLCGEYDGLRGEGV
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgttctcagattaattatgccattgataaagcgcatgccatcgccgaaaccttt
cgactgtgcctgcccgattttgcatatttcaccgccgatgcctggcgacagcaggattgg
gctaaatggcgtgaagtgcgtgatctccagctgggatgggacattaccgactttggccgc
ggggattttgcgcaaaccgggctgacgttgctgacgttgcgtaatggtttgttgggttca
gcaaactatcccaagccctatgccgaaaaaatgctacaaattcagcaagatcaacaaaca
ccgtggcattttcatacgcataaaatggaagacattgtgaatcgtggcggcggtgattta
tgtatgcagctggcgtgggcgacacccgatgcgcagtatgacggtcagcgagcggttgag
gtcaacgtggatggtcaacggcgcagctgcaaacctggtgatacgctggtactgaaaccg
gggcagggcgtgtgcctgccgccgcgcttgtatcatcgcttctgggccgagaaagcgttt
gtgctgggctgggaaatctcgatggtgaatgacgaccagcacgataaccacttcctcgaa
ccgggcggtcgcttcccggcgataacagagaacgagccggtaaaatggctgttatgcggc
gaatatgatggtttacggggagagggtgtgtaa

DBGET integrated database retrieval system