KEGG   Conexibacter woesei: Cwoe_0440Help
Entry
Cwoe_0440         CDS       T01153                                 

Definition
(GenBank) acetaldehyde dehydrogenase (acetylating)
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
cwo  Conexibacter woesei
Pathway
cwo00360  Phenylalanine metabolism
cwo00362  Benzoate degradation
cwo00620  Pyruvate metabolism
cwo00621  Dioxin degradation
cwo00622  Xylene degradation
cwo00650  Butanoate metabolism
cwo01100  Metabolic pathways
cwo01120  Microbial metabolism in diverse environments
cwo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cwoe_0440
   00650 Butanoate metabolism
    Cwoe_0440
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Cwoe_0440
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Cwoe_0440
   00622 Xylene degradation
    Cwoe_0440
   00621 Dioxin degradation
    Cwoe_0440
Enzymes [BR:cwo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Cwoe_0440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh TrkA_N Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ADB48876
UniProt: D3F7A5
Position
449536..450420
Genome map
AA seq 294 aa AA seqDB search
MRKATAAIVGSGNIGTDLMYKLLRSEWVQPRWMVGVDPASEGLARAQAEGLETTAEGVDA
LLDGDELPDILFEATSAYVHAANAPRYREAGILAVDLTPAALGPYVVPPVNLREHLGEPN
LNMVTCGGQATIPIVAAVSRVAEVEYAEIVASVASVSAGPGTRANIDEFTRTTAAAVAAV
GGARRSKAIIVFNPAEPPMIMRDTVYCSLPPGVDRDAIARSIGEMVADVQEYVPGYRLLT
EPQFDGDRVAVLLEVEGAGDFLPPYSGNLDIMTAAAAKVGDELARLRVGAGASR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaggccaccgccgcgatcgtcggctccggcaacatcgggaccgacctgatgtac
aagctgctgcgctcggagtgggtccagccgcgctggatggtcggcgtcgaccccgccagc
gaagggctcgcgcgggcgcaggccgagggcctcgagacgaccgccgagggcgtcgacgcg
ctgctcgacggcgacgagctgcccgacatcctgttcgaggcgacctccgcctacgtccac
gccgccaacgcgccgcgctaccgcgaggctggcatcctcgccgtcgacctgacgccggcc
gcgctcgggccgtacgtcgtgccgcccgtcaacctgcgcgagcacctcggcgagccgaac
ctcaacatggtcacgtgcggcgggcaggcgacgatcccgatcgtcgccgccgtcagccgc
gtcgccgaggtcgagtacgccgagatcgtcgcctcggtcgcgtccgtctcggccggcccg
gggacgcgcgcgaacatcgacgagttcacgcgcacgaccgccgccgccgtcgccgcagtc
ggcggggcgagacgcagcaaggcgatcatcgtcttcaacccggccgagccgccgatgatc
atgcgcgacaccgtctactgctcactgccgcccggcgtcgatcgtgacgcgatcgcgcgc
tcgatcggtgagatggtcgccgacgtgcaggagtacgtgcccggctaccggctgctgacc
gagccgcagttcgacggcgaccgcgtcgcggtcctgctcgaggtcgagggcgcgggcgac
ttcctgccgccgtacagcggcaacctcgacatcatgaccgcggccgcggcgaaggtcggc
gacgagctggcgcgcctgcgcgtcggcgcgggggcgtcgcgatga

DBGET integrated database retrieval system