KEGG   Conexibacter woesei: Cwoe_0654Help
Entry
Cwoe_0654         CDS       T01153                                 

Definition
(GenBank) Arginase/agmatinase/formiminoglutamase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
cwo  Conexibacter woesei
Pathway
cwo00220  Arginine biosynthesis
cwo00330  Arginine and proline metabolism
cwo01100  Metabolic pathways
cwo01110  Biosynthesis of secondary metabolites
cwo01130  Biosynthesis of antibiotics
cwo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Cwoe_0654
   00330 Arginine and proline metabolism
    Cwoe_0654
Enzymes [BR:cwo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Cwoe_0654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ADB49089
UniProt: D3F9C2
Position
699235..700167
Genome map
AA seq 310 aa AA seqDB search
MTTSPFELVNRPAARPLLVIGAALDSSGSGRGEVRAAARLREAGLVERLGARDFGDLDVS
VEDPERDPRSGVIGLRDLVSASRTIRDAVASALVAGWRPLVLGGCCSVVPGTLAGVRRTL
GPASLVVVDGHLDLFDGTTSRTGEMGRMDLAIVLGHGPPELTSLDGDPPLAEASDVVAVG
DGDHPRRVTLRAPGPAEIAPDLRVIDCGEVTQRGARQVGVHVAELAGGGSAPFWLHLDVD
VVDGEAMPAVSSPVATGLSWDQVAELLAPALRSPRLIGMTVCGYNPDLDAGGEFAYCIVD
LLADGLLRSR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacctcgccgttcgagctcgtcaaccgcccagcggcgcgtccgttgctcgtgatc
ggcgccgcgctcgacagctcgggctctggccgcggtgaggttcgcgcggccgcgcgcctg
cgcgaggccgggctcgtcgagcggctcggcgcgcgtgacttcggcgacctcgacgtcagc
gtcgaggacccggagcgcgacccgcgctctggcgtgatcggcttgcgcgacctcgtcagc
gcgtcgcgcacgatccgcgacgcggtcgcttcggcgctcgtggccggctggcgcccgctc
gtgctgggaggctgctgctcggtcgtcccggggacgctcgcgggcgtgcggcgcacgctc
gggccggcgtcgctcgtggtcgtcgacggtcacctcgacctgttcgacggcacgacctcg
cgcaccggcgagatgggccgcatggacctcgcgatcgtgctcggccacggtccgccggag
ctgacgtcgctcgacggcgatccgccgctggcggaggcgtccgacgtggtcgcggtcggc
gacggcgaccatcctcgccgcgtcacgctgcgtgcgccgggtccggccgagatcgcgccc
gacctgcgggtgatcgactgcggcgaggtgacgcagcgcggcgcacgccaggtcggcgtc
cacgtcgccgagctggcgggcggcggctcggcgccgttctggctgcacctggacgtggat
gtggtcgacggggaggcgatgccggcggtcagctcccccgtcgcgaccgggctgtcgtgg
gatcaggtggcggagctgctcgcgcccgcgctgcgctcaccgcggctgatcggcatgacc
gtctgcggctacaaccccgatctggacgccggcggcgagttcgcgtactgcatcgtcgac
ttgctcgcggacggtctgctgaggagccgatag

DBGET integrated database retrieval system