KEGG   Conexibacter woesei: Cwoe_0773Help
Entry
Cwoe_0773         CDS       T01153                                 

Definition
(GenBank) glycine oxidase ThiO
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
cwo  Conexibacter woesei
Pathway
cwo00730  Thiamine metabolism
cwo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cwo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Cwoe_0773
Enzymes [BR:cwo01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     Cwoe_0773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 Pyr_redox_2 FAD_oxidored GIDA HI0933_like Pyr_redox NAD_binding_8 Lycopene_cycl Amino_oxidase 3HCDH_N Pyr_redox_3 Thi4 FAD_binding_3 GMC_oxred_N
Motif
Other DBs
NCBI-ProteinID: ADB49206
UniProt: D3FAD7
Position
813014..814192
Genome map
AA seq 392 aa AA seqDB search
MPQPSQPTFDVAVVGGGIIGLAVAWRAQQRGLRTVLLERDAQIAQGATHAAAGMLAPVSE
ANTAERELLALGLESAARYPQFVAELAESSALDPGFLRCGTLVVARDRDEAEALDRERAV
RAQLGLDVERLLPSEARRREPGLAPTLRLALDVPDDHAVDPRALALALAAALRAAGGDLR
TGAAVQRIDTSAGDSRVSGVTLAGGERIAAEHVVVAAGAWTQQLAGLPGDACVPVRPVKG
QILRLRDPAGPGLFTRVLRMDPGYLVPRGDGRYVLGATMEERGYDTDVTAGGVFELLRDA
SELVPGISELILEELEAGLRPGTPDNAPALGPGALAGLHWAAGHHRNGILLAPVTADLLL
ASLLGDPLGELAAPFTPTRFGAQAKKGKEVAA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtgccccaaccatcgcaaccaacgttcgacgtcgccgtcgtgggcggcgggatcatcggc
ctcgccgtcgcatggcgcgcgcagcagcgcgggctgcggacggtgctgctggagcgcgac
gcgcagatcgcacagggcgcgacgcacgcggccgccggcatgctcgcgccggtcagcgag
gcgaacaccgccgagcgggagctgctcgcgctcgggctggagagcgccgcgcgctacccg
cagttcgtcgcggagctggccgagtcgagcgcgctcgatcccggcttcctgcgctgcggc
acgctcgtcgtcgcgcgcgaccgcgacgaggcggaggcgctcgaccgcgagcgcgccgtc
cgcgcccagctcggcctcgacgtcgagcggctgctgccgagcgaggcgcgtcgccgcgag
cccggcctcgcgccgacgctgcggctcgcactcgacgtgcccgacgaccacgccgtcgac
ccgcgagcgctcgcgctcgcgctcgccgccgcgctgcgtgccgccggcggcgacctgcgc
acgggcgccgcggtgcagcggatcgacacgagcgccggcgactcgcgcgtcagcggcgtc
acgctcgcgggcggcgagcggatcgctgccgagcacgtcgtcgtcgcggccggcgcgtgg
acgcagcagctcgccggcctgcccggtgacgcgtgcgttccggtccgccccgtcaagggc
cagatcctgcggctgcgcgatcccgccggtcccggcctcttcacgcgcgtcctgcggatg
gatcccggctacctcgtaccgcgcggcgacggtcgctacgtgctcggcgcgacgatggag
gagcgcggctacgacaccgacgtcaccgccggcggcgtcttcgagctgctgcgcgacgcg
agcgagctggtccccggcatctccgagctgatcctcgaggagctggaggcggggctgcgg
ccgggcacgcccgacaacgcgccggcgctcggccccggcgcgctcgccggcctccactgg
gccgccggacaccaccgcaacgggatcctgctcgcgccggtcacggccgacctgctgctc
gcctcgctgctcggcgacccgctcggggagctggcggccccgttcacaccgacgcgcttc
ggcgcacaagccaagaagggcaaggaggtcgccgcatga

DBGET integrated database retrieval system