KEGG   Conexibacter woesei: Cwoe_1140Help
Entry
Cwoe_1140         CDS       T01153                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cwo  Conexibacter woesei
Pathway
cwo00010  Glycolysis / Gluconeogenesis
cwo00620  Pyruvate metabolism
cwo00640  Propanoate metabolism
cwo00680  Methane metabolism
cwo01100  Metabolic pathways
cwo01110  Biosynthesis of secondary metabolites
cwo01120  Microbial metabolism in diverse environments
cwo01130  Biosynthesis of antibiotics
cwo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cwoe_1140
   00620 Pyruvate metabolism
    Cwoe_1140
   00640 Propanoate metabolism
    Cwoe_1140
  Energy metabolism
   00680 Methane metabolism
    Cwoe_1140
Enzymes [BR:cwo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Cwoe_1140
Lipid biosynthesis proteins [BR:cwo01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Cwoe_1140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADB49571
UniProt: D3FDJ7
Position
1198953..1200950
Genome map
AA seq 665 aa AA seqDB search
MADTAAGDSGTSLEQRLDAMLEIERFDPSQQFREQALLSDPAVYERAARDPQGWWAEQAE
ALDWFERWDTVLDDSEPPFYKWFTGGKLNVSYNCLDRHVDAGRGDRVAYHWRGEEGERRD
VTYAELHRDVQRFANALKDLGVQQGDVVGIYLPMIPEVVVAMLACARIGAPHNVVFGGFS
AESVKERMEFSEAKVLVTVDGARRKGKTAPIKATVDEHMGDLASLKTVVVVRHARLDGVP
MTAGRDVWFDEVCAAAAADCPAEPLDAEHPLFILYTSGSTASPKGILHTTGGYLTGVAAT
HRYVFDLKPDEDVWWCAADVGWITGHSYIVYGPLANGATSVMWEGAPDYPHKGIWWEVAE
ETRATLLYAAPTAIRTFMKWGHEIPERYDLSALRLLGSVGEPINPKAWLWYHQVIGGGRC
PIVDTWWQTETGAIMITPLPGITSTKPGSATTPFPGVAAEVVGEGDGEPIDSGQGLLVLT
QPWPSMLRTLYKEDERFVETYFARFGKERYLVGDAARRDRDGYLWIIGRIDDVVNVSGHR
LSTAEVESAIVAHEKVAEAAVIGQSDEDTGQAICAFVTLNGEIEGTDELIAEIGAVVAER
IGKFARPKRIIWADDLPKTRSGKIMRRLLRDIAEGRALGDVTTLRDPSVMASLESQIKDA
QSSEQ
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggcagacaccgcagcaggagattccggcacgtcgctcgagcagcggctcgacgcgatg
ctcgagatcgagcgcttcgacccgtcgcagcagttccgcgagcaggcgctgctgagcgat
ccggcggtctacgagcgggccgcgcgcgacccgcaggggtggtgggccgagcaggccgag
gcgctcgactggttcgagcgctgggacacggtcctcgacgactccgagccgccgttctac
aagtggttcaccggcggcaagctgaacgtctcgtacaactgcctcgaccgccacgtcgac
gccggccgcggcgatcgcgtcgcctaccactggcgcggcgaggaaggcgagcggcgcgac
gtcacgtacgccgagctgcaccgcgacgtgcagcgcttcgccaacgcgctgaaggacctc
ggcgtgcagcagggcgacgtcgtcgggatctacctgccgatgatccccgaggtcgtcgtc
gcgatgctcgcctgcgcccgcatcggcgcgccgcacaacgtcgtcttcggcggcttcagc
gccgagtcggtcaaggagcggatggagttctccgaggcgaaggtgctggtgaccgtcgac
ggcgcccgccgcaagggcaagacggcgccgatcaaggcgacggtcgacgagcatatgggt
gatctcgcgtcgctgaagacggtcgtggtcgtcagacacgcccggctcgacggcgtgccg
atgacggccggcagagacgtctggttcgacgaggtctgcgcggccgctgcggccgactgc
ccggccgagccgctcgacgccgagcacccgctgttcatcctctacacgtccggctcgacc
gcctcgccgaaggggatcctgcacacgaccggcggctacctgaccggcgtcgcggcgacg
cacagatacgtcttcgacctcaagcccgacgaggacgtctggtggtgcgcggccgacgtc
ggctggatcaccggccactcctacatcgtctacggcccgctcgccaacggcgccacgtcg
gtgatgtgggagggcgcgcccgactatccccacaaggggatctggtgggaggtcgccgag
gagaccagagcgacgctgctgtacgccgcgccgacggcgatccgcacgttcatgaagtgg
ggtcacgagatcccggagagatacgacctctccgcgctgcggctgctcggctccgttggc
gagccgatcaacccgaaggcgtggctctggtaccaccaggtgatcggcggcggccgctgc
ccgatcgtcgacacgtggtggcagacggagaccggcgcgatcatgatcacgccgctgccg
gggatcacctcgaccaagcccggctccgcgacgacgccgttcccgggcgtcgccgccgag
gtcgtcggcgagggcgacggcgagccgatcgacagcggccagggcctgctggtgctgacg
cagccgtggccgtcgatgctgcgcacgctctacaaggaggatgagcgcttcgtcgagacg
tacttcgcgcgcttcggcaaggagcgctacctcgtcggcgacgccgcgcgcagggacaga
gacggctacctctggatcatcgggcggatcgacgacgtcgtgaacgtctccggccaccgc
ctctccacggccgaggtcgagtcggcgatcgtcgcccacgagaaggtcgccgaggcggcc
gtgatcggtcagtccgacgaggacaccggccaggcgatctgcgcgttcgtgacgctcaac
ggcgagatcgaggggaccgacgagctgatcgccgagatcggcgccgtcgtcgccgagcgg
atcggcaagttcgcgcgcccgaagcggatcatctgggccgacgacctgccgaagacgcgc
tcgggcaagatcatgcgccgccttctgcgcgacatcgccgagggccgcgccctgggcgac
gtcacgacgctgcgcgacccgagcgtgatggcgtcgctggagagccagatcaaggacgcc
cagtcgagcgagcagtga

DBGET integrated database retrieval system