KEGG   Conexibacter woesei: Cwoe_2855Help
Entry
Cwoe_2855         CDS       T01153                                 

Definition
(GenBank) anthranilate phosphoribosyltransferase
  KO
K00766  anthranilate phosphoribosyltransferase [EC:2.4.2.18]
Organism
cwo  Conexibacter woesei
Pathway
cwo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cwo01100  Metabolic pathways
cwo01110  Biosynthesis of secondary metabolites
cwo01130  Biosynthesis of antibiotics
cwo01230  Biosynthesis of amino acids
Module
cwo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cwo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cwoe_2855
Enzymes [BR:cwo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     Cwoe_2855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N ACD DUF913
Motif
Other DBs
NCBI-ProteinID: ADB51274
UniProt: D3FAW1
Position
3047622..3048653
Genome map
AA seq 343 aa AA seqDB search
MARDLLTRAIDTLASGEDLSADDAAAVLAEIWSGNATDVQIAAVLIALRTKGETVDELTG
LARTMREFAAHVEISRDDLLDVVGTGGGRQTFNVSTTAALIAAGAGCAVAKHGNRSATGL
SGAADVLEALGASIDLEPVQVARCIEQVGFGFMFAPHHHAAMRYVIPVRKQLAVRTIMNF
LGPLTSPAGVTRQLTGVSDRRYHETIAGAFARLGATHVLIASSDDGLDELSTVAPTRVIE
VRDGEISEFRISAADVGLDTAAYDDLRGGTPDVNAEVTRRILAGERGAPRDIAVLNAGAG
IYASGRADTLEAGVRAAEAAIDSGAARATLTNYVTQTQELATA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgggacctgctcacgcgcgcgatcgacacgctcgcctctggcgaggacctttcg
gctgacgacgcagccgcggtgctggcggagatctggagcggcaacgcgaccgatgtgcag
atcgccgccgtgctgatcgcgctgcgcacgaagggggagacggtcgacgagctgaccggc
ctcgcgcgcacgatgcgcgagttcgccgcgcacgtcgagatctcgcgcgacgacctgctc
gacgtcgtcggcaccggcggcggcagacagaccttcaacgtgtcgaccaccgcggcgctg
atcgcggccggcgccggctgcgcggtcgccaagcacggcaaccgctcggcgacggggctc
tcaggcgcggcggacgtgctggaggcgctcggcgcgagcatcgatctcgaaccggtccag
gtcgcgcgctgcatcgagcaggtcggcttcggcttcatgttcgcgcctcaccaccacgcg
gcgatgcgctacgtgatcccggtgcgcaagcagctcgccgtccgcacgatcatgaacttc
ctcgggccgctgacgagccccgccggcgtgacgcgccagctgaccggcgtcagcgacagg
cgctaccacgagacgatcgccggcgcgttcgcccgcctcggcgccacgcacgtgctgatc
gcctccagcgacgacggcctcgacgagctcagcacggtcgcgccgacgcgcgtgatcgag
gtgcgcgacggcgagatctcggagttccgcatcagcgccgccgacgtcggcctcgacacc
gccgcctacgacgacctgcgcggcggcacccccgacgtcaacgccgaggtcactcggcgg
atcctcgcgggcgagcgcggcgccccgcgcgacatcgccgtcctcaacgccggcgccgga
atctacgcaagcggccgtgctgacacgctcgaagcaggcgtgcgggcggccgaggcggcg
atcgactcgggcgccgcgagagctaccttgaccaactacgtcacgcagacccaggagctg
gcaaccgcatga

DBGET integrated database retrieval system