KEGG   Conexibacter woesei: Cwoe_2887Help
Entry
Cwoe_2887         CDS       T01153                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
cwo  Conexibacter woesei
Brite
KEGG Orthology (KO) [BR:cwo00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Cwoe_2887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ADB51306
UniProt: D3FAZ3
Position
complement(3084937..3086049)
Genome map
AA seq 370 aa AA seqDB search
MDNDIILFIVVATALAFDFTNGFHDTANVVATSISTRAMKPKVAVTMAAILNFIGAFLSL
EVATTIANNIVDQADVTTTIVFAGLVGAIVWNLVTWYFGLPSSSSHALIGGVVGAMLVAV
GTGAIHGDGIVSKVLVPALIAPLLAFSAAGLAILCCYRIVGRLAPGPVSRGFRVGQIFSG
GLLALAHGTNDAQKTMGIITLALIANGNLGSDAEVPMWVVVSAATAIALGTYMGGWRIIK
TMGSRIIKMDAAQGFAAQGAGSAVILAATHFGYPLSTTHTISGAVMGAGAAKRLSAVRWG
VAGNILVAWVLTLPCSALVGGLVYAVTHLFGDGALGPIVVAAAGVAFVLFMFIRRLQKGA
AITTTAESNA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggacaacgacatcatcctcttcatcgtcgtcgcgacggcgcttgcgttcgacttcacg
aacgggttccacgacacggccaacgtcgtcgcgacgtcgatctcgacgcgcgcgatgaag
ccgaaggtcgccgtcacgatggccgcgatcctgaacttcatcggcgcgttcctgtcgttg
gaggtcgcgaccacgatcgcgaacaacatcgtcgaccaggccgacgtgaccacgacgatc
gtcttcgccggcctcgtcggagcgatcgtctggaacctcgtcacgtggtacttcgggctg
ccgtcgagcagctcgcacgcgctcatcggcggcgtcgtcggcgcgatgctggtcgcggtc
gggacgggcgcgatccacggcgacgggatcgtctcgaaggtgctcgtgccggcgctgatc
gcgccgctgctcgcgttctccgcggccgggctggcgatcctctgctgctaccggatcgtc
gggcgattggcgcccggaccggtcagccggggcttccgcgtcgggcagatattctcaggc
ggcctgctggcgctcgcgcacggcaccaacgacgcgcagaagacgatgggcatcatcacg
ctcgcgctgatcgcgaacggcaacctcggcagcgatgccgaggtcccgatgtgggtcgtc
gtctcggccgcgaccgcgatcgcgctcggcacctacatgggcggctggcggatcatcaag
acgatgggcagccgcatcatcaagatggacgccgcccagggcttcgccgcgcagggcgcc
ggctccgcggtgatcctcgccgcgacgcacttcggctacccgctctcgacgacgcacacg
atctccggtgccgtgatgggcgccggcgcggcgaagcggctgtcggccgtgcgctggggc
gtcgcgggcaacatcctcgtcgcgtgggtgctgacgctgccttgctcggcgctcgtcggc
gggctcgtctacgccgtcacgcacctcttcggcgacggagcgctcggcccgatcgtcgtc
gcggcggccggcgtcgcgttcgtgctgttcatgttcatccgccgcctgcagaagggcgcg
gcgatcaccacgacggcggagagcaacgcatga

DBGET integrated database retrieval system