KEGG   Conexibacter woesei: Cwoe_3191Help
Entry
Cwoe_3191         CDS       T01153                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cwo  Conexibacter woesei
Pathway
cwo00260  Glycine, serine and threonine metabolism
cwo00750  Vitamin B6 metabolism
cwo01100  Metabolic pathways
cwo01110  Biosynthesis of secondary metabolites
cwo01120  Microbial metabolism in diverse environments
cwo01230  Biosynthesis of amino acids
Module
cwo_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cwoe_3191
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cwoe_3191
Enzymes [BR:cwo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cwoe_3191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP HypA TF_Zn_Ribbon
Motif
Other DBs
NCBI-ProteinID: ADB51610
UniProt: D3FDZ4
Position
3400746..3401981
Genome map
AA seq 411 aa AA seqDB search
MPPVSLTCKECKTVYELEAKYVCERCFGPLEVAYAAPTDVDADELRRRIQAGPHSLWRYR
DFLPLAGAPPRDTLPAGWTPLLRADRLAERLGIGELWIKNDAANPTHSFKDRVVAVALAR
AKELGFQTIACASTGNLANAVAAHAAAAGLDSYVFIPSDLEEQKILATGVYGTNLVAVRG
NYDDVNRLCTEVAGEHEWAFVNINMRPYYSEGSKTIAYEIAEQLGWSVPDRIVAPIASGS
LFTKVAKGFEEWIELGLVDGAVPTMNGAQATGCSPVATAFGEGTDICRPVKPDTIAKSLA
IGNPADGPYAVELARKTGGGIDAVTDDEIRAGIKLLAETTGIFTETAGGVTTAVLAKLAA
RGDIDASERVVAVITGEGLKTLDVVRGTFETHLIEPSYEAFEAVVPGAVAA
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgccgccagtgtcactgacctgcaaagaatgcaagaccgtctatgagctcgaggcgaag
tacgtctgcgagcgctgcttcggtcccctcgaagtcgcctacgcggcgccgaccgatgtc
gacgccgacgagctgcgccgccgcatccaggcggggccgcactcgctgtggcgctaccgc
gacttcctcccgctcgccggcgcgccgccgcgcgacacgctgccggccgggtggacgccg
ctgctgcgcgccgaccggctcgcggagcggctcggcatcggcgagctgtggatcaagaac
gacgccgcgaacccgacgcactcgttcaaggatcgcgtcgtcgccgtcgcgctcgcgcgt
gcgaaggagctgggcttccagacgatcgcgtgcgcatcgaccggcaacctcgccaacgcc
gtcgccgcgcacgccgcggcggccggcctcgactcctacgtcttcatcccgtccgacctc
gaggagcagaagatcctcgcgaccggcgtctacggcacgaacctcgtcgccgtcagaggg
aactacgacgacgtcaaccgcctctgcaccgaggtcgctggcgagcacgaatgggcgttc
gtgaacatcaacatgcgcccgtactactccgagggctccaagacgatcgcgtacgagatc
gccgagcagctcggctggtcggtccctgatcggatcgtcgcgccgatcgcctccggctcg
ctcttcacgaaggtcgcgaagggcttcgaggagtggatcgagctgggtctcgtagacggc
gcggtgccgacgatgaacggcgcacaggcgaccggctgctcgcccgtcgccactgcgttc
ggcgagggcaccgacatctgccgtccggtcaagccggacacgatcgccaagtccctcgcg
atcggcaacccggccgacgggccgtacgcggtcgagctggcgcgcaagaccggcggcggg
atcgacgccgtcaccgacgacgagatccgcgccggcatcaagctgctggccgagacgacg
ggcatcttcaccgagacggcgggcggcgtcacgacggcggtgctcgcgaagctcgccgca
cgcggcgacatcgacgccagcgagagagtcgtcgccgtcatcaccggcgagggcctgaag
acgctcgacgtcgtgcgcggcacgttcgagacgcacctgatcgaaccgagctacgaggcg
ttcgaggcggtcgtccccggcgcggtggccgcctga

DBGET integrated database retrieval system