KEGG   Conexibacter woesei: Cwoe_4135Help
Entry
Cwoe_4135         CDS       T01153                                 

Definition
(GenBank) class II aldolase/adducin family protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
cwo  Conexibacter woesei
Pathway
cwo00051  Fructose and mannose metabolism
cwo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Cwoe_4135
Enzymes [BR:cwo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Cwoe_4135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II Prok-JAB
Motif
Other DBs
NCBI-ProteinID: ADB52550
UniProt: D3F4U3
Position
complement(4398542..4399264)
Genome map
AA seq 240 aa AA seqDB search
MSSTERLIEQVAWSCRILAGEGYQDLTLGHVSARGEDDRTVYIKRRGVALSEVTPADVLA
FDLDGDPADAPGGMHLEAVLHTAVYRRRPDVRCVVHGHPPYATAFSATDADFEFLTHDGV
LFIDGLPTFDGVPELIVDEQQGGAVADALGDGSTLLLRNHGVLVAERSVAWATLTAVLLE
RSVQLQSIASTLGALRPIPDELVEQIHKGKYRDGFADEYWDAWVRDLRRNGNAFGMPAGD
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtgtcctccacggagcggttgatcgagcaggtcgcgtggtcgtgccggatcctggcgggc
gagggctaccaggacctcacgctgggccacgtcagcgcgcgcggcgaggacgatcggacc
gtgtacatcaagcgcagaggcgtcgcgctgagcgaggtcacgccggccgacgtgctggcg
ttcgacctcgacggcgacccggccgacgcgcccggcggcatgcacctggaggcggtcctc
cacaccgccgtgtacaggcggcgcccggacgtccgctgcgtcgtgcacggccacccgccg
tacgcgaccgcgttcagcgcgaccgacgccgacttcgagttcctgacgcacgacggcgtg
ctcttcatcgacgggctgccgacgttcgacggcgtccccgagctgatcgtcgacgagcag
cagggcggcgccgtcgccgacgcgctcggcgacggctcgacgctgctgctgcgcaaccac
ggcgtgctcgtcgccgagcgcagcgtcgcctgggcgacgctgaccgccgtgctgctggag
cgcagcgtgcagctgcagtcgatcgcctcgacgctcggcgcgctgaggccgatccccgac
gagctggtcgagcagatccacaagggcaagtaccgcgacggcttcgccgacgagtactgg
gacgcctgggtccgcgacctgcgccgcaacggcaacgccttcggcatgcccgcgggcgac
tga

DBGET integrated database retrieval system