KEGG   Conexibacter woesei: Cwoe_4149Help
Entry
Cwoe_4149         CDS       T01153                                 

Definition
(GenBank) protein of unknown function UPF0052 and CofD
  KO
K11212  LPPG:FO 2-phospho-L-lactate transferase [EC:2.7.8.28]
Organism
cwo  Conexibacter woesei
Pathway
cwo00680  Methane metabolism
cwo01100  Metabolic pathways
cwo01120  Microbial metabolism in diverse environments
Module
cwo_M00378  F420 biosynthesis
Brite
KEGG Orthology (KO) [BR:cwo00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Cwoe_4149
Enzymes [BR:cwo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.28  2-phospho-L-lactate transferase
     Cwoe_4149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0052
Motif
Other DBs
NCBI-ProteinID: ADB52564
UniProt: D3F5L5
Position
4413945..4414919
Genome map
AA seq 324 aa AA seqDB search
MSAVGPVVLLAGGTGGAKLAAGLAGALGTTADAPDELVVVANTGDDVELYGAHVSPDPDL
IAFHLAERIDARGWGLDGDTFHVMDGLRELGVEVWFNLGDRDLAYGIERARRLAAGDRLT
DAIGDLARALRVPARVLPMSDEPVRSRVRAQGRAWEFQEFMIVGRGAGPVEGLEFRGVED
ARPTPEVLDAIAAARAIVIGPSNPLLSIGPILALPGMREALRATAAPVVAVSPIVGGAVL
KGPTAAFLEWAGQPVSAAGVTALYGDVLDGIVCDEPLDPPVGGSPDGSPEAAIPVHTADL
LMSDGADRRRLAGETLAFAAVLAG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgccgtgggccccgtcgtcctgctcgccggcggcaccggcggggcgaagctcgcg
gcggggctggccggcgcgctcggcaccaccgcggacgcacccgacgagctggtcgtcgtc
gccaacaccggcgacgacgtcgagctgtacggcgcgcacgtctcgcccgaccccgacctg
atcgcgttccacctcgccgagcgcatcgacgcgcgcggctgggggctcgacggcgacacc
ttccacgtgatggacggcctgcgcgagctgggcgtcgaggtctggttcaacctcggcgac
cgcgacctcgcgtatgggatcgagcgcgcccgccggctcgccgccggcgaccgcctgacc
gacgcgatcggcgacctcgcgcgcgcgctgcgcgtgcccgcgcgcgtcctgccgatgtcg
gacgagccggtccgctcgcgcgtgcgcgcgcagggccgcgcgtgggagttccaggagttc
atgatcgtcggcagaggggcgggaccggtcgaggggctcgagttccgcggcgtcgaggac
gcgcgcccgacgcccgaggtgctcgacgcgatcgcggccgcccgcgcgatcgtgatcggg
ccgtccaacccgctgctgtcgatcggcccgatcctcgcgctgccggggatgcgcgaggcg
ctgcgggccaccgccgccccggtcgtcgccgtcagcccgatcgtcggcggcgccgtgctg
aagggcccgacggccgcgttcctggagtgggcgggccagcccgtctccgcagctggcgtg
acggcgctctacggcgacgtgctcgacgggatcgtctgcgacgagccgctcgacccgccg
gtcggcggctcgccggacggctcgccggaggccgcgatcccagtccacacggccgatctg
ctcatgtccgacggcgctgaccgcagacgtctggcaggcgagacgctcgccttcgcggcc
gtgctcgcgggctga

DBGET integrated database retrieval system