KEGG   Conexibacter woesei: Cwoe_4213Help
Entry
Cwoe_4213         CDS       T01153                                 

Definition
(GenBank) HpcH/HpaI aldolase
  KO
K08691  malyl-CoA/(S)-citramalyl-CoA lyase [EC:4.1.3.24 4.1.3.25]
Organism
cwo  Conexibacter woesei
Pathway
cwo00630  Glyoxylate and dicarboxylate metabolism
cwo00660  C5-Branched dibasic acid metabolism
cwo00680  Methane metabolism
cwo01100  Metabolic pathways
cwo01120  Microbial metabolism in diverse environments
cwo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cwo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Cwoe_4213
   00660 C5-Branched dibasic acid metabolism
    Cwoe_4213
  09102 Energy metabolism
   00680 Methane metabolism
    Cwoe_4213
Enzymes [BR:cwo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.24  malyl-CoA lyase
     Cwoe_4213
    4.1.3.25  (S)-citramalyl-CoA lyase
     Cwoe_4213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ADB52627
UniProt: D3F5S8
Position
4473677..4474732
Genome map
AA seq 351 aa AA seqDB search
MRNPRDFGAPLAVGAPTPLLEIPFPPSRMIHFLDASNEKMVAKVPDIAKKTDILLGNLED
AVPVDRKEAAREGLVTVGQTYDLGETQLWTRVNSLDSPWVLDDLLRLVGAIGNRLDVIMV
PKVEGAWDIHYVDRLLAQLEARFNVERPILVHAILETALGVANLEEIAAASPRMQGMSFG
PADLAASRRMKTTRVGGGHPGYVSLSDPDGDNPRVTAQQDLWHYSIARMVDACAATGILP
FYGPFGDISDDEGCEAQFRAAFLLGCVGAWSLHPKQIAIAKKVFSPDPDEVRFAKRVIEA
IPDGRGVHMLDGKMQDDATWKQCKVMVSLAELLAKKDPELAEAYGFEPATA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaccctcgtgatttcggcgccccgctcgcggtcggcgcaccgaccccgctgctg
gagatcccgttcccgccctcgcggatgatccacttcctcgacgcgagcaacgagaagatg
gtggcgaaggtccccgacatcgccaagaagaccgacatcctgctcggcaacctcgaggac
gcggtgccggtcgatcgcaaggaggccgcgcgcgaagggctcgtcacggtcggccagacc
tacgacctcggcgagacgcagctgtggacccgcgtcaacagcctcgactcgccatgggtg
ctcgacgacctgctgcggctcgtcggcgcgatcgggaacagactcgacgtgatcatggtc
ccgaaggtcgagggcgcgtgggacatccactacgtcgaccgcctgctggcgcagctcgag
gcgagattcaacgtcgagagaccgatcctcgtgcacgcgatcctggagacggcgctcggc
gtcgcgaacctcgaggagatcgccgctgccagcccgcgcatgcagggcatgagcttcggc
ccggccgacctcgccgcctcgcgccgcatgaagacgacgcgcgtcggcggcggccacccg
ggctacgtctcgctgtcggaccccgacggcgacaacccgcgcgtcaccgcgcagcaggac
ctctggcactactcgatcgcgcgcatggtcgacgcctgcgcggcgaccgggatcctcccc
ttctacggcccgttcggcgacatctccgacgacgagggctgcgaggcgcagttccgcgcc
gccttcctgctcggctgcgtcggcgcctggtcgctgcacccgaagcagatcgcgatcgcg
aagaaggtcttctcgcccgatcccgacgaggtcagattcgccaagcgggtgatcgaggcg
ataccggacggccgcggcgtccacatgctcgacggcaagatgcaggacgacgccacctgg
aagcagtgcaaggtgatggtcagcctcgccgagctgctcgcgaagaaggatccggagctg
gccgaggcctacggcttcgagcccgcgaccgcgtag

DBGET integrated database retrieval system