KEGG   Conexibacter woesei: Cwoe_4461Help
Entry
Cwoe_4461         CDS       T01153                                 

Definition
(GenBank) aminoglycoside phosphotransferase
  KO
K17910  aminoglycoside 2''-phosphotransferase [EC:2.7.1.190]
Organism
cwo  Conexibacter woesei
Brite
KEGG Orthology (KO) [BR:cwo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:cwo01504]
    Cwoe_4461
Enzymes [BR:cwo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.190  aminoglycoside 2''-phosphotransferase
     Cwoe_4461
Antimicrobial resistance genes [BR:cwo01504]
 Gene variants
  Aminoglycoside resistance genes
   O-Phosphotransferases
    Cwoe_4461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APH DUF1679
Motif
Other DBs
NCBI-ProteinID: ADB52875
UniProt: D3F7Y1
Position
complement(4757239..4758135)
Genome map
AA seq 298 aa AA seqDB search
MTDVADLRARLTERLPGLEIRSVTEMLNGWDSVVLDVNDELIARFPKRDEVLVQLEKELP
LLAELDRRLPGRVPAPTRVGAPTDPDRFLTYSKLHGVALSPELASGSHGPALADQIGELL
TVVHGIDTAMVVGFGIPEASAGDWRAQYVELYERISDGVLPTLDPAERASIEQTWRTFLD
DPANFAFTPTLVHGDLACEHILCDAGQGTVTGVIDWGDARLGDPAFDFVGLYAECGWDFT
RAVAAAYGGEPGATWEQRVAFYTFVIPFIGLLAGAELGDEGILAEARDGLAALLAERA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgatgttgccgacctgcgcgctcgcctgaccgagcgcctgccggggttggagatc
cgcagcgtgaccgagatgctgaacggctgggactcggtcgtgctcgacgtcaacgacgag
ctgatcgcgcgcttccccaagcgcgacgaggtgctggtccagctcgagaaggagctgccg
ctgctcgccgagctggatcggcggctgccgggtcgcgtgccggcgccgacgcgagtgggc
gccccgacggatcccgatcgcttcctcacctacagcaagctccacggcgtcgcgctctcc
cccgagcttgcgagcggctcgcatggcccggcgctggcggatcagatcggcgaactgctc
acggtcgtccacgggatcgacactgcgatggtggtcgggttcggcatcccggaggcgagc
gccggcgactggcgcgcacagtacgtcgagctgtacgagcgcatctccgatggggttctg
ccgacgctcgatccggccgagagggcgagcatcgagcagacctggcgcacgttcctcgac
gatccggcgaacttcgccttcacgccgacgctcgtccacggcgacctcgcctgcgagcac
atcctctgcgacgcggggcagggcacggtcacgggcgtgatcgactggggcgacgcgaga
cttggcgacccggcgttcgacttcgtcggcctctacgccgagtgcgggtgggacttcacc
cgtgctgtcgcggccgcatacggcggtgagccgggggcgacgtgggagcagcgggtcgcc
ttctacaccttcgttatcccgttcatcggcctgctggccggtgccgagctgggcgacgag
gggatcctcgcggaagcgcgcgacgggctcgccgcgctgctggccgagcgggcgtga

DBGET integrated database retrieval system