KEGG   Conexibacter woesei: Cwoe_4893Help
Entry
Cwoe_4893         CDS       T01153                                 

Definition
(GenBank) transcriptional regulator, IclR family
  KO
K13641  IclR family transcriptional regulator, acetate operon repressor
Organism
cwo  Conexibacter woesei
Brite
KEGG Orthology (KO) [BR:cwo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cwo03000]
    Cwoe_4893
Transcription factors [BR:cwo03000]
 Prokaryotic Type
  Helix-turn-helix
   IclR family
    Cwoe_4893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IclR HTH_IclR MarR_2 HTH_11 Rrf2 HTH_20 TrmB HTH_Crp_2 HTH_24 HTH_5 RepL
Motif
Other DBs
NCBI-ProteinID: ADB53305
UniProt: D3FBB3
Position
5221136..5221924
Genome map
AA seq 262 aa AA seqDB search
MADSGGHESVDRALRVIEQLGTSGSGYTLEELAEATAVPKSTLHRTLAALKARGYAAQPR
AGGVYTLGPQLLAVAFGFYERLDVRGLIHPLLVRARDAFGETVHMGVLAGGDVVYLDKVE
SLKPLKMTSVIGGRNPAHATAVGKALLAWTHPFEHELTEWIETYGPLTARTPDTIVEPER
LHAALREVRGRGWAMEYEESEPGVRCVAVPIFLGRSEPAAAISVAGPKQRLTDRQVREIA
PRLRDLAGEAFGPPRRPSRTKA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggcggacagcggcggacacgagagcgtcgaccgcgcgctgcgcgtgatcgagcagctc
gggacgagcggcagcggctacacgctggaggagctggcggaggcgacggcggtgccgaag
tcgacgctgcaccgcacgctcgccgcgctgaaggcgcgcggctacgccgcccagccccgc
gccggcggcgtctacacactcggcccgcagctgctcgcggtcgcgttcggcttctacgag
cggctcgacgtgcgcgggctgatccacccgctgctggtgcgggcgcgcgacgcgttcggc
gagacggtccacatgggagtgctcgccggtggcgacgtcgtctacctcgacaaggtcgag
tcgctcaagccgctgaagatgaccagcgtgatcggcggccgcaaccccgcccacgcgacc
gccgtcggcaaggcgctgctcgcctggacgcacccgttcgagcacgagctgacggagtgg
atcgagacgtacggcccgctgaccgcgcgcacgccggacacgatcgtcgagcccgagcgg
ctgcacgcggcgctgagagaggtgcgcgggcgcggctgggcgatggagtacgaggagagc
gagccgggcgtgcgctgcgtcgcggtcccgatcttcctcggccgcagcgagcccgcggcg
gcgatcagcgtcgccgggcccaagcagcgcctgaccgaccgtcaggtgcgcgagatcgcg
ccgaggctgcgcgacctcgccggcgaggcgttcggcccgccgagaagaccgtcgcgaacg
aaggcttga

DBGET integrated database retrieval system