KEGG   Conexibacter woesei: Cwoe_4896Help
Entry
Cwoe_4896         CDS       T01153                                 

Definition
(GenBank) ABC transporter related protein
  KO
K01995  branched-chain amino acid transport system ATP-binding protein
Organism
cwo  Conexibacter woesei
Pathway
cwo02010  ABC transporters
cwo02024  Quorum sensing
Module
cwo_M00237  Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Cwoe_4896
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Cwoe_4896
Transporters [BR:cwo02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    Cwoe_4896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran BCA_ABC_TP_C AAA_21 SMC_N AAA_23 AAA_29 AAA_22 RsgA_GTPase AAA_25 FeoB_N AAA_30 GAF AAA_15 AAA MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: ADB53308
UniProt: D3FC13
Position
complement(5223554..5224351)
Genome map
AA seq 265 aa AA seqDB search
MTDTTDTAPVGEPLLRIEGVVKRFGGVRAVDGASFDVRRGSITALIGPNGAGKTTLFNVV
TGFEHGAEGTVEYDGRSIAGKPSYAIARRGMVRTFQITKALAAMPVIDNMTLAAPHQPGE
HIVGLCIHPRAAHRREREVEERACELLETFGLAAKRDEYAGTLSGGQRKLLELARVLMVE
PRMVLLDEPMAGVNPTLGGRLLEHVHALRERDGTTFLLIEHDMEVVMGHSDRVVCMAQGR
VIADGDPESVRTDQRVIDAYLGGAA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
gtgactgacacgaccgacacggcgcccgtcggcgagccgctgctgcgcatcgagggcgtc
gtcaagcggttcggcggcgtgcgcgcggtcgacggcgccagcttcgacgtgcgacgcggc
tcgatcaccgcgctgatcggccccaacggcgccggcaagacgacgctcttcaacgtcgtc
accggcttcgagcacggtgccgaggggacggtcgagtacgacgggcgctcgatcgcgggc
aagccgtcctacgcgatcgcgcgccgcgggatggtgcgcacgttccagatcacgaaggcg
cttgcggcgatgccggtgatcgacaacatgacgctcgcggcgccgcaccagccgggcgag
cacatcgtcggcctctgcatccacccgcgcgccgcgcaccggcgcgagcgcgaggtggag
gagcgtgcgtgcgagctgctggagacgttcggcctcgccgccaagcgcgacgagtacgcc
ggcacgctctcgggcgggcagcgcaagctgctggagctggcgcgcgtgctgatggtcgag
ccgcggatggtgctgctcgacgagccgatggcgggcgtcaacccgacgctcggcggtcgt
ctgctggagcacgtgcacgcactgcgcgagcgggacgggacgaccttcctgctgatcgag
cacgacatggaggtcgtgatgggccactccgaccgcgtcgtctgcatggcgcaggggagg
gtgatcgccgacggcgatccggagtcggtgcggaccgatcagcgcgtgatcgacgcgtac
ctgggcggggcggcgtga

DBGET integrated database retrieval system