KEGG   Conexibacter woesei: Cwoe_4897Help
Entry
Cwoe_4897         CDS       T01153                                 

Definition
(GenBank) inner-membrane translocator
  KO
K01998  branched-chain amino acid transport system permease protein
Organism
cwo  Conexibacter woesei
Pathway
cwo02010  ABC transporters
cwo02024  Quorum sensing
Module
cwo_M00237  Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Cwoe_4897
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Cwoe_4897
Transporters [BR:cwo02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    Cwoe_4897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2 DUF883
Motif
Other DBs
NCBI-ProteinID: ADB53309
UniProt: D3FC14
Position
complement(5224344..5225306)
Genome map
AA seq 320 aa AA seqDB search
MSPVLAVSLDALTSADFWIGVGVLAGTYAIFTLGLQLNVGFTGIINFGQAGFMAIGAYGM
GILVVRAGWSLWAALPVATLMAMAAGVLIGLPSLRLRADYFAIVTIAFAEIVRYVAQNAR
GLTGGNQGLLGFDDQWLDVSDTILGWLPESMQEQFLLPLLLVVWATVAILTVLLKLLQRS
PWGRVLRAIREDEDAARALGKNVLAYKLQSIALAAALGAIAGYFLALNLSFLSPEEFEPQ
FTFIGFTILILGGLASYVGVALASVIIWALLEATRFVDLPLAAEKVAALRFIIVGVALIL
LVAFRPQGLLGKREEMVLRD
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgagcccggtcctcgcggtcagcctcgacgcgctcacctcggccgacttctggatcggc
gtcggcgtgctcgcgggcacctacgcgatcttcacgctcgggctgcagctgaacgtcggc
ttcaccggcatcatcaacttcggccaggccggcttcatggcgatcggcgcctacgggatg
gggatcctcgtcgtcagagcgggctggtcgctgtgggcggcgctgccggtcgcgacgctg
atggcgatggctgccggcgtgctgatcggcctgccgtcgctgcggctgcgagccgactac
ttcgcgatcgtcacgatcgccttcgccgagatcgtccgctacgtcgcgcagaacgcgcgc
ggcctgacgggcgggaaccagggcctgctcggcttcgacgaccagtggctcgacgtctcc
gacacgatcctcgggtggctgccggagtcgatgcaggagcagttcctgctgccgctgctg
ctggtcgtgtgggcgacggtcgcgatcctcaccgtgctgttgaagctgctgcagcgcagc
ccgtgggggcgcgtcctgcgggcgatccgcgaggacgaggacgcggcgcgcgcgctcggc
aagaacgtgctcgcgtacaagctgcagtcgatcgcgctggcggcggcgctgggcgcgatc
gccggctacttcctcgcgctcaacctgtcgttcctgagccccgaggagttcgagccgcag
ttcaccttcatcggcttcacgatcctgatcctcggcggcctcgccagctacgtcggcgtc
gcgctcgcctcggtgatcatctgggcgctgctggaggcgacgcgcttcgtcgacctgccg
ttggcggcggagaaggtcgccgcgctgcggttcatcatcgtcggggtcgcgctgatcctg
ctggtcgcgttccgcccgcagggcctgctcggcaagcgagaggagatggtgctgcgtgac
tga

DBGET integrated database retrieval system