KEGG   Conexibacter woesei: Cwoe_4898Help
Entry
Cwoe_4898         CDS       T01153                                 

Definition
(GenBank) inner-membrane translocator
  KO
K11956  neutral amino acid transport system permease protein
Organism
cwo  Conexibacter woesei
Pathway
cwo02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Cwoe_4898
Transporters [BR:cwo02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Neutral amino acid transporter [MD:M00322] [OT]
    Cwoe_4898
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2
Motif
Other DBs
NCBI-ProteinID: ADB53310
UniProt: D3FC15
Position
complement(5225303..5226331)
Genome map
AA seq 342 aa AA seqDB search
MSNSADTAIRPGRAERPGWTASALGAGRGPLGVTLAIVAVIVLVLIAAYGLHDVAQRGVN
GLVSGSYFALGAVGLTLVYGTLRLVNFAHGELLTFGAYMAFLANVTWGVPLIAATLFAIV
LTAALGVLTERTMWRPMRARGAGLLQLLLMTLGLAFVLRYGIQMIWGTVPRRLDVDVTDS
ISFLGLRIGRTELIVVVVGITTLVAVGLMLRLTSLGRQMRALADDMALAEVTGIDTDRVV
VATWIFAAGLAGLAGVLYTAAIGTLTPNLGFFLLLSLFAAVILGGIGNAYGALAGGLLLG
LAQEWSTLVIDARWKVAVGFGILILVLIVRPQGLFGRKERTV
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagcaattccgccgacacggcgatccggcccgggcgcgccgagcgcccgggctggacc
gcctcggcgctcggggccggtcgcggcccgctcggcgtgacgctcgcgatcgtggcggtg
atcgtgctcgtgctgatcgccgcctacggcctgcacgacgtcgcacagcggggcgtcaac
ggcctcgtctcgggtagctacttcgcgctcggcgcagtcggcctgacgcttgtctacggg
acgctgcggctcgtcaacttcgcacacggcgagctgctcacgttcggcgcctacatggcg
ttcctggcgaacgtcacgtggggcgtgccgctgatcgccgcgacgctcttcgcgatcgtc
ctgaccgccgcgctcggggttctgaccgagcgcacgatgtggcggccgatgcgggcgaga
ggcgccggcctgctgcagctgctgctgatgacgctcgggctcgcgttcgtcctccgctac
ggcatccagatgatctggggcaccgtgccgcgccggctcgacgtcgacgtgaccgactcg
atctcgttcctcgggctgcggatcggccgcaccgagctgatcgtcgtcgtcgtcggcatc
acgacgctcgtcgcggtcggcctgatgctgcggctgacgtcgctgggccggcagatgcgc
gcgctcgccgacgacatggcgctcgccgaggtgaccggcatcgacaccgaccgcgtcgtc
gtcgcgacgtggatcttcgccgccggcctcgcaggtctcgccggcgtgctctacacggcg
gcgatcggcacgctgacgccgaacctcggcttcttcctgctgctgagcctgttcgcggcc
gtgatcctcggcggcatcgggaacgcctacggcgcgctcgccggcgggctgctgctcggc
ctcgcgcaggagtggtcgacgctcgtgatcgacgcgcgctggaaggtcgccgtcggcttc
gggatcctgatcctggtgctgatcgtgcggccgcagggtctgttcggccgcaaggagcgc
accgtatga

DBGET integrated database retrieval system