KEGG   Conexibacter woesei: Cwoe_4914Help
Entry
Cwoe_4914         CDS       T01153                                 

Definition
(GenBank) sulfate ABC transporter, periplasmic sulfate-binding protein
  KO
K02048  sulfate transport system substrate-binding protein
Organism
cwo  Conexibacter woesei
Pathway
cwo00920  Sulfur metabolism
cwo02010  ABC transporters
Module
cwo_M00185  Sulfate transport system
Brite
KEGG Orthology (KO) [BR:cwo00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Cwoe_4914
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Cwoe_4914
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cwo02000]
    Cwoe_4914
Transporters [BR:cwo02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Sulfate transporter [MD:M00185] [OT]
    Cwoe_4914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_11 SBP_bac_1 SBP_bac_8 SBP_bac_6 PBP_like_2 PBP_like
Motif
Other DBs
NCBI-ProteinID: ADB53326
UniProt: D3FC31
Position
complement(5240311..5241351)
Genome map
AA seq 346 aa AA seqDB search
MKSRTPVVLALIATLVALVVAGCGGASDEKGGDASASGSSDADTTLSLVAYSTPEVVYDE
IIPDFARTADGRGVAFKTSFGASGDQSRAVEAGQKADVVSFSVEPDMTRLTDAGLVADDW
NRGANRGLVTTSVVSFVVRRGNPKNFRTWDDLLRPGVKVLTPNPFTSGAAKWNLLAAYGQ
AARGGADPEAGLAYVRTLINDHVPVQDRSGREALQNFINGDADVLLSYEYEATTAQKKGE
EVDYVIPDDTIRIDIDIATTRDAPAEARTFLDYVLSEPAQQRFADWGYRPVNETVLAANR
ARFPTPSGLFTIDDLGGWSRVNDEFFDIENGSIAKIEEEAGVSTAK
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatcacgcacccccgtcgtcctcgccctcatcgcaactctcgtcgccctcgtggtc
gccggctgcggtggcgcgtcggacgagaagggtggggacgcgtcggcgagcggatcgagc
gacgctgacacgacgctgtcgctcgtggcgtactccacgcccgaggtcgtctacgacgag
atcatccccgacttcgcgagaaccgccgacggcagaggcgtcgcgttcaagacgtcgttc
ggcgcctccggcgaccagagccgcgcggtcgaggcgggccagaaggccgacgtcgtctcg
ttctcggtcgagcccgacatgacgcgcctgacggacgccggtctcgtcgccgacgactgg
aacagaggcgccaacagaggcctcgtcacgacctccgtcgtctccttcgtggttcgcaga
ggcaaccccaagaacttcagaacgtgggacgacctgctcagaccgggcgtgaaggttctg
acgccgaacccgttcacctccggcgcggcgaagtggaacctgctcgcggcgtacggccag
gcggcgagaggcggcgcggaccccgaggccggcctcgcctacgtcagaacgctgatcaac
gaccacgtgccggtgcaggacagatcgggccgcgaggcgctgcagaacttcatcaacggc
gacgccgacgtgctgctctcctacgagtacgaagcgaccaccgcgcagaagaagggcgaa
gaggtcgactacgtcatacctgacgacacgatcagaatcgacatcgacatcgcgacgacg
agagacgcgccggcagaggcgagaacgttcctcgactacgtgctgtcggagcccgctcag
cagcgcttcgccgactggggctaccgcccggtcaacgagacggtcctcgcggccaacaga
gccagattcccgacgccgtccggtctcttcacgatcgacgacctcggcggctggtcgaga
gtgaacgacgagttcttcgacatcgagaacggctcgatcgccaagatcgaggaagaggcg
ggagtgtcgaccgccaagtga

DBGET integrated database retrieval system