KEGG   Conexibacter woesei: Cwoe_4921Help
Entry
Cwoe_4921         CDS       T01153                                 

Definition
(GenBank) hypothetical protein
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADB53333
UniProt: D3FC38
Position
5248566..5249489
Genome map
AA seq 307 aa AA seqDB search
MRADPVSLGALAAAEADGNESWAEDTYAYGPLSLGITAAAVNEAAQHCEDLFALLRFLRE
PIYFARDMANYGAGKVVEFGRKLDRADDATISQLFLVPPPEVVREGLTRAGDPDAAVAHA
EEGRVRLGAMVRETATFYRSFEDFHVQYKHGLKLPLRPFGTPTEEAIDERKTDLEAPLFS
YTTEPIESQARRSPTDQPIMFKASPAQRADLLRLVRERNLLRLQMVAKVGLDELVERSHT
VLRLLQIAQENRLALGRLEEGNQRFVVPGLRRWEQVEVLIGIDRTLSLNDFADPTGSPTN
RGKRRRR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgccgacccggtgtccctcggtgcgctggcggccgcggaggcggacggaaacgag
agctgggccgaggatacgtacgcctacggcccgctctcactcggcatcacggcggccgcc
gtgaacgaagctgcgcagcactgcgaggatctgttcgcgcttctgcggtttctgcgcgag
ccgatctacttcgctcgcgacatggccaactacggcgccggaaaggtcgtcgagttcggg
cgcaagctcgacagagccgatgacgccaccatcagccagctctttttggttccaccaccg
gaggtggtgcgtgaagggctgacccgtgcaggcgatcctgacgcggccgtcgcgcacgcc
gaggaggggcgcgttcgtcttggagcgatggtccgcgagacggcaacgttctaccgttcc
ttcgaggattttcacgtccagtacaaacatgggttgaagttgccgctccgtccgttcggc
accccaactgaagaggcgatcgacgagcggaagacggacctcgaggcgccgctgttctcc
tacacgactgagccgatcgagtcgcaggcacgccgctcgccgaccgaccagccgatcatg
ttcaaggccagccccgcccagcgggctgacctgctgcggttggtgagagagcggaacctg
ctgcgcctgcagatggtcgcgaaggtcggcttggacgagttggtcgagcgctcccacacc
gtcctgcgcctgttgcagatcgcccaggagaaccggcttgcgctcggccgcctcgaagag
ggcaaccagaggttcgtcgttcccggactgcggagatgggagcaggtcgaggtgctgatc
gggatcgaccggacgctctcgttgaacgacttcgctgatccgaccggatcgcccacgaac
cgaggcaagcgccgtcgacgttga

DBGET integrated database retrieval system