KEGG   Conexibacter woesei: Cwoe_4923Help
Entry
Cwoe_4923         CDS       T01153                                 

Definition
(GenBank) amino acid permease-associated region
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease Gram_pos_anchor Na_Ala_symp
Motif
Other DBs
NCBI-ProteinID: ADB53335
UniProt: D3FC40
Position
complement(5250321..5251748)
Genome map
AA seq 475 aa AA seqDB search
MGATKRRFGGGRRPLHAGGTAGVEAEARERAEAPGGLKKAIGRNMLLFFVVGDVLGAGIY
ALVGEVGGRVGGAIWTSFAVALALAFLTAFAYAELVTKYPRAAGAALYVNKAFRMPFLTF
LVAFAVMCSGITSAATLSTAFGGDYLKQFLDVPTVMAGLVFIIVVALINFRGISESVKLN
IGLTCIELGGLLLITVIAAAAVLNGDGDAGRALDFKEGETVPIAILAGAALAFYALIGFE
DSVNVAEETEQPQRDYPRALFGGLLAAGVVYLTVTVLASMAVPTDRLASSTGPLLEVAQV
GPLSIDPKVFAAIALFAVANGALINMIMASRLVYGMSREGIVPRFFGGVHKGRQTPLPAI
VFTTALCMLLIAIGTLEKLADTTVTLLLCVFILVNVSVLVLRRDPVDHDHFHAPSAIPVI
GAVVCATLLTQQPSSSFPLAGGLMALGVVLYFVSRRATGPTDMDTGRLEAVEHPR
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgggagcgacgaagagacggttcgggggcggcagaaggccgctgcacgccggcggcacg
gccggcgtcgaggcggaggcgcgcgagcgcgccgaggcgcccggcggtctgaagaaggcg
atcggccgcaacatgctgctcttcttcgtcgtcggcgacgtgctcggcgcgggcatctac
gcgctcgtcggcgaggtcggcgggcgcgtcggcggagcgatctggacgtcgttcgcggtc
gcgctggcgctcgcgttcctgaccgcgttcgcctacgccgagctggtcacgaagtacccg
cgcgcggcgggcgcggcgctgtatgtcaacaaggcgttccgcatgccgttcctgacgttc
ctcgtcgcgttcgcggtgatgtgctcggggatcacgtcggccgcgacgctgtcgaccgcg
ttcggcggcgactacctgaagcagttcctcgacgtgccgaccgtgatggcggggctcgtc
ttcatcatcgtcgtcgcgctgatcaacttccgcggcatctcggagtcggtgaagctcaac
atcggcctcacgtgcatcgagctgggcggcctgctgctgatcaccgtgatcgccgcggcg
gcggtcctcaacggcgacggcgacgccggtcgcgcgctcgacttcaaggagggcgagacc
gtcccgatcgcgatcctcgccggcgccgcgctcgcgttctacgcgctgatcggcttcgag
gactcggtcaacgtcgcggaggagaccgagcagccgcagcgcgactatccgcgcgcgctg
ttcggcggcctgctcgcggcgggcgtcgtgtatctcaccgtcacggtgctcgcctcgatg
gccgtgccgaccgacagactcgcctcctcgaccggcccgctgctggaggtcgcgcaggtc
ggcccgctgtcgatcgacccgaaggtgttcgccgcgatcgccctgttcgccgtcgccaac
ggcgcgctgatcaacatgatcatggcctcccgcctcgtctacgggatgagccgcgagggg
atcgtgccgcgcttcttcggcggcgtccacaagggccgtcagacgccgctgccggcgatc
gtcttcacgactgcgctgtgcatgctgctgatcgcgatcgggacgctcgagaagctcgcc
gacacgaccgtgacgctgctgctgtgcgtgttcatcctcgtcaacgtctcggtgctcgtg
ctgcgcagagaccctgtcgaccacgaccacttccacgcgcccagcgcgatcccggtgatc
ggagcggtcgtctgcgcgacgctgctgacgcagcagccgtccagctcgttcccgctcgcc
ggcgggctgatggcgctcggcgtcgtcctctacttcgtcagccgccgggcgacgggaccg
accgacatggacacggggcggctggaggcggtcgagcacccgcggtag

DBGET integrated database retrieval system