KEGG   Conexibacter woesei: Cwoe_4927Help
Entry
Cwoe_4927         CDS       T01153                                 

Definition
(GenBank) hypothetical protein
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Zn_Tnp_IS91 DZR zf-ribbon_3 FYVE DNA_RNApol_7kD Ribosomal_S27e Lar_restr_allev zinc_ribbon_2 RNHCP Ribosomal_S27 zf-NADH-PPase zf-HYPF Cys_rich_CPXG Ribosomal_L37e TF_Zn_Ribbon
Motif
Other DBs
NCBI-ProteinID: ADB53339
UniProt: D3FC44
Position
5255397..5255591
Genome map
AA seq 64 aa AA seqDB search
MPYVACPHCGHRTFSVAYWSNREHCGACGRELPSPRTAGAEQDQQAFPQPRAQPLSRRSE
QPSK
NT seq 195 nt NT seq  +upstreamnt  +downstreamnt
atgccctacgttgcctgtcctcactgcggccaccgcaccttcagcgtcgcgtactggtcc
aaccgcgagcactgcggagcatgcggccgggagcttccctcgccgcgcacggcgggcgcc
gagcaggaccagcaggcgttcccgcaaccgcgcgcacagccgctgtcgaggcgcagcgag
cagccgtcgaagtag

DBGET integrated database retrieval system