KEGG   Conexibacter woesei: Cwoe_4928Help
Entry
Cwoe_4928         CDS       T01153                                 

Definition
(GenBank) putative phosphohistidine phosphatase, SixA
  KO
K08296  phosphohistidine phosphatase [EC:3.1.3.-]
Organism
cwo  Conexibacter woesei
Brite
KEGG Orthology (KO) [BR:cwo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Cwoe_4928
Enzymes [BR:cwo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.-  
     Cwoe_4928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADB53340
UniProt: D3FC45
Position
complement(5255640..5256080)
Genome map
AA seq 146 aa AA seqDB search
MIWLLRHGDAADAHGDQADAERPLTEKGRGQARAAGLALARLGVRLDACLSSPRVRALDT
ATLACDALGIEVQVVAQLSGGAFDAEELAAPHGRDVLLVGHEPDFSQAVGELTGGLVQMK
KGGLAGIEERELRVLLRPAELRAIAG
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgatctggctgctgcggcacggcgacgccgcggacgcgcacggcgaccaggccgacgcc
gagcgtccgctcacggagaaggggcggggtcaggcgcgcgccgccgggctcgcactcgcg
cggctcggcgtgcggctcgatgcctgcctgtcgagcccgcgtgtgcgcgcgctcgacacc
gccacgctcgcgtgcgatgcgctcggcatcgaggtgcaggtggtcgcgcagctgagcggc
ggcgccttcgacgccgaggagctggccgcgccgcacggccgcgacgtgctgctcgtcggc
catgagcccgacttctcgcaggccgtcggcgagctgaccggcggtctcgtgcagatgaag
aagggcggcctggcggggatagaggagcgcgagctgcgcgtcctgctgcgcccggccgag
ctgcgcgcgatcgccggctga

DBGET integrated database retrieval system