KEGG   Conexibacter woesei: Cwoe_4929Help
Entry
Cwoe_4929         CDS       T01153                                 

Definition
(GenBank) Auxin Efflux Carrier
  KO
K07088  uncharacterized protein
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mem_trans
Motif
Other DBs
NCBI-ProteinID: ADB53341
UniProt: D3FC46
Position
5256181..5257140
Genome map
AA seq 319 aa AA seqDB search
MLAIVVAIAASIAAGAALERRSNRAAHAARSFALRSMLWVLAPFATYVNLAHADLELDAL
AGGLIAIAALGVTGVVAWQLARGPLRLERRSIGAYVHCSVQSNTGYLGLPLCAVLFDQHG
LAQAIVYDVLISLATFAVGGFALGAAFGDAAGRRAADGAGRRGAVALDLARAVVLRNPIL
LSASAGLLVPEAWAPDFLLTPAKVAIFAMLPLGFLAVGVTLADEADDGTLRIPPPLTRAV
GSVVALRMLLMPALFLLCTLFLDVPEPYLLLAAMPVGLNTLIVAHATGLDLRLCASAITW
STSIAIVGVLALSLTGVLG
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgcgatcgtcgtcgcgatcgccgcgtcgatcgcggccggcgccgcgctcgagcgg
cgctcgaaccgcgcggcgcacgccgcgcggagcttcgcgctgcgctcgatgctgtgggtg
ctcgcgccgttcgccacctacgtcaacctcgcgcacgccgacctcgagctggacgcgctc
gccggcgggctgatcgcgatcgccgcgctcggcgtcaccggcgtcgtcgcgtggcagctc
gcgcgcggcccgctgcgactcgaacgccgctcgatcggcgcctacgtccactgctcggtg
cagtcgaacaccggctatctcggcctgccgctgtgcgcggtcctgttcgaccagcacggg
ctggcgcaggcgatcgtctacgacgtgctgatctcgctcgcgacgttcgccgtcggcggc
ttcgcgctcggcgccgcgttcggcgacgcggccggacggcgcgccgcggacggcgccggc
cgccggggcgcggtcgcgctcgacctcgcgcgcgccgtcgtcctgcgcaacccgatcctg
ctgtccgccagcgccggcctgctcgtgccggaggcgtgggcgcccgatttcctgctgacg
cccgcgaaggtggcgatcttcgcgatgctgccgctcggcttcctcgccgtcggcgtgacg
ctcgccgacgaggccgacgacggcacgctgcggatcccgccgccgctgacgcgcgccgtc
ggctcggtcgtcgcgctgcggatgctgctgatgccggcgctgttcctgctctgcacgctg
ttcctcgacgtgcccgagccgtacctcctgctcgccgcgatgccggtcgggctcaacacg
ctgatcgtcgcgcacgcgaccggcctcgacctgcgcctgtgcgcctccgcgatcacgtgg
agcacgtcgatcgcgatcgtcggcgtgctcgcgctgtcgctgaccggcgtgctcggctga

DBGET integrated database retrieval system