KEGG   Conexibacter woesei: Cwoe_4944Help
Entry
Cwoe_4944         CDS       T01153                                 

Definition
(GenBank) binding-protein-dependent transport systems inner membrane component
  KO
K02053  putative spermidine/putrescine transport system permease protein
K02054  putative spermidine/putrescine transport system permease protein
Organism
cwo  Conexibacter woesei
Pathway
cwo02024  Quorum sensing
Module
cwo_M00193  Putative spermidine/putrescine transport system
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Cwoe_4944
Transporters [BR:cwo02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Putative spermidine/putrescine transporter [MD:M00193]
    Cwoe_4944
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 DUF3981
Motif
Other DBs
NCBI-ProteinID: ADB53355
UniProt: D3FC60
Position
5271908..5273674
Genome map
AA seq 588 aa AA seqDB search
MGSVEAQPLSERGGGGRGGRTRRAGRALPRPRIGRGAAFLAPLTLLTLVAFDVPLALLLG
QSVFDPSATTANYREVVETEAYTRILGSTLRVAAITTAICLLLGYPLALWLARMAPARRR
IAIALLVLPFWVSILVRAYAWLVLLGNNGAVNRGLIELGIVGSPVQFLYDSAGVTLGTVS
ILLPFLVLPLYAGIARVDTRLLGAAASLGAGPATVLRRVLLPLTFPAALAGAVLVFVLTL
GFFVTPAVLGGGKVPLLATLLDALVNDVGDWGLAAALSVLLLAATALAFALVARLAGRGA
LVGAMGGGATASETALHRAPVAPVTRGGRVALGTIGCVTFALLVAPVLVVVPMSFSSAAT
LEFPPPGFSLRWYDALFSDATWLDAARSSALLALAASAIALVLGAAAAYGLARRRGHGGG
LLLAHFVAPVATPTIITAVALYVAGAKTGLLGSWGGLLAAHVVLVAPFVVIVLAPAFRTV
DERLERAAWSLGASRLTALRRVVLPPLLPSLLSAWLFAFLVSFDELVVTYFVAGTHETLP
KRMFNELAVEITPMVTAVSTLLVALTAAALALSLAAGRRAGGRSPPTD
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgggaagcgtggaagctcagccgctgagcgagcgcggcggcggcggccgcggcggccgc
acgcgccgcgcaggtcgcgccctcccccgcccgcggatcgggcggggggcggcgttcctc
gcgccgctgacgctgctgacgctcgtcgccttcgacgtcccgctcgcgctgctgctcggg
cagagcgtcttcgacccgtccgcgacgaccgccaactaccgcgaggtcgtcgagaccgag
gcgtacacgcggatcctcggctcgacgctgcgcgtcgcggcgatcacgaccgcgatctgc
ctgctgctcggctacccgctcgcgctctggctcgcgcgaatggcgccggcccgccgacgg
atcgcgatcgcgctgctggtgctgccgttctgggtctcgatcctcgtgcgcgcgtacgca
tggctcgtgctgctcggcaacaacggcgccgtcaaccgcgggctgatcgagctggggatc
gtcggcagccccgtgcagttcctctatgacagcgccggcgtcacgctcggcaccgtctcg
atcctgctgccgttcctggtgctgccgctgtacgccgggatcgcgcgcgtcgacacgcgc
ctgctcggcgccgccgcgtcgctcggcgccggccccgcgaccgtgctgcggcgcgtgctg
ctgccgctgaccttccccgcggcactggccggtgcggtgctcgtgttcgtgctgacgctc
ggcttcttcgtcacgcccgcggtgctcggcggcggcaaggtgccgctgctggcgacgctg
ctcgacgcgctcgtcaacgacgtcggcgactggggtctggcggcggcgctgtcggtgctg
ctgctggccgcgaccgcgctcgccttcgcgctcgtcgcgcggctcgccggccgcggcgcg
ctggtcggcgcgatgggcggcggcgcgacggcgagcgagacggcgctgcaccgcgcgccg
gtcgcgcccgtcacgcgcggcggccgcgtcgcgctcggcacgatcggctgcgtcacgttc
gcgctgctcgtagcgccggtgctcgtcgtcgtgccgatgtcgttctcaagcgccgcgacg
ctggagttcccgccgcccggcttctcgctgcgctggtacgacgcgctcttctccgacgcg
acctggctcgacgccgcgcgctcctccgccctgctcgcactcgccgccagcgcgatcgcg
ctcgtgctcggcgcggccgccgcctacgggctcgcgcgccgccgcgggcacggcggcggt
ctgctgctcgcgcacttcgtcgcgccggtcgcgacgccgacgatcatcaccgccgtcgcg
ctctacgtcgcgggcgcgaagaccggtctgctcggcagctggggcgggctgctggccgcg
cacgtcgtgctcgtcgcgccgttcgtcgtgatcgtgctggcgccggcattccggacggtc
gacgagcggctggagcgggccgcctggtcgctcggcgcgtcgcggctgacggcgctgcgg
cgtgtcgtgctgccgccgctgctgccgagcctgctgtcggcgtggctgttcgccttcctc
gtcagcttcgacgagctggtcgtgacgtacttcgtcgcgggcacgcacgagacgctgccg
aagcggatgttcaacgagctggcagtcgagatcacgccgatggtcacggccgtctcgacg
ctgctcgtcgccctcaccgcggccgcgctcgcgctgtcgctcgccgccggccgtcgtgcc
ggcggcagatcaccgccaaccgactga

DBGET integrated database retrieval system