KEGG   Conexibacter woesei: Cwoe_4947Help
Entry
Cwoe_4947         CDS       T01153                                 

Definition
(GenBank) hypothetical protein
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PASTA HemolysinCabind DUF4148
Motif
Other DBs
NCBI-ProteinID: ADB53358
UniProt: D3FC63
Position
complement(5277934..5279349)
Genome map
AA seq 471 aa AA seqDB search
MRRTSVFRAVLLALLLALAVSGTASAGQLTNEGGWWVFRAAPGERNDFRASVAQLGRAGY
LQFNDTGVTLGALGPGCYREDFERDDLGTQRCPIAGTVGIRAELGDGDDWGIVGDDLPGI
PVVFDGGPGNDRLNGPLRGVGVTFSGGDGTDELDGGDLGDVLDGGPGNDRVEGDGGNDVV
RGGDGDDLVEGDSLSVGSDTIDGGPGYDRSEADWIQQGASAGLAISIDGVANDGHPGEND
NVVDLEEVTLTQPAGFVAGGAGVRVRIYNHGQGSSNVAGGPGADNIRTHDYNDTIDGKGG
DDTIEGGYGDDTITGGPGKDSINAEAGTGSCNFLVCRVGGGNDTIQVRDGEVDSVVCGVG
TDTVVADANDTIAADCENVDRGTPPTRRPTPTRRPTPRRAPAKACVVPKVKAGSKLPAVK
KALAKRGCGAKTKKVRSAKVRKGRVVKLSHKAGKRLAHKKAVTVFVSRGRR
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgagacgaacttctgtatttcgagctgttctgctcgcgctgctgctggcgctcgccgtc
agcggcaccgcctcggccgggcagctcaccaacgagggcggctggtgggtcttccgcgcc
gcgcccggtgagagaaacgacttccgcgcctcggtcgcgcagctggggagagcgggctac
ctgcagttcaacgacacgggcgtcacgctcggcgcgctcggtcccggctgctaccgcgag
gacttcgagagagacgacctcgggacgcagcgctgcccgatcgccggcaccgtgggcatc
cgcgccgagctgggcgacggcgacgactggggcatcgtcggcgacgacctgccgggcatc
ccggtcgtcttcgacggcggccccggcaacgacagactcaacggcccgctgcgcggcgtc
ggcgtcaccttctccggcggcgacggcaccgacgagctcgacggcggcgacctcggcgac
gtgctcgacggcggccccggcaacgacagagtcgagggcgacggcggcaacgacgtcgtc
cgcggcggcgacggcgacgacctcgtcgagggcgacagcctctcggtcggctccgacacg
atcgacggcggtcccggctatgaccgctccgaggccgactggatccagcagggcgccagc
gccggcctcgcgatctcgatcgacggcgtcgccaacgacggccatcccggcgagaacgac
aacgtcgtcgacctcgaggaggtcacgctcacgcagccggccggcttcgtcgccggcggc
gcgggcgtgagagtcagaatctacaaccacggccagggctcctcgaacgtcgcgggcggc
cccggcgccgacaacatccgcacgcacgactacaacgacacgatcgacggcaagggcggc
gacgacacgatcgagggcggctacggcgacgacacgatcaccggcggccccggcaaggac
tcgatcaacgccgaggccggcaccggctcgtgcaacttcctcgtctgccgcgtcggcggc
ggcaacgacacgatccaggtccgcgacggcgaggtcgacagcgtcgtctgcggcgtcggc
accgacaccgtcgtggccgatgcgaacgacacgatcgcggccgactgcgagaacgtcgac
cgcggcaccccgccgacgagaagaccgactccgacgagaagaccgacgccgagaagagct
cccgccaaggcctgcgtcgtcccgaaggtgaaggcgggctcgaagctgccggccgtcaag
aaggcgcttgccaagcgcggctgcggtgcgaagacgaagaaggtcagatccgcgaaggtc
cgcaaggggcgcgtcgtgaagctctcgcacaaggcgggcaagcggctcgcgcacaagaag
gcagtgaccgtgttcgtctcgcgcggtcgccgctga

DBGET integrated database retrieval system