KEGG   Conexibacter woesei: Cwoe_4949Help
Entry
Cwoe_4949         CDS       T01153                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
cwo  Conexibacter woesei
Pathway
cwo00030  Pentose phosphate pathway
cwo00480  Glutathione metabolism
cwo01100  Metabolic pathways
cwo01110  Biosynthesis of secondary metabolites
cwo01120  Microbial metabolism in diverse environments
cwo01130  Biosynthesis of antibiotics
cwo01200  Carbon metabolism
Module
cwo_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
cwo_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:cwo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Cwoe_4949
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Cwoe_4949
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cwo04147]
    Cwoe_4949
Enzymes [BR:cwo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     Cwoe_4949
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     Cwoe_4949
Exosome [BR:cwo04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Cwoe_4949
  Exosomal proteins of colorectal cancer cells
   Cwoe_4949
  Exosomal proteins of bladder cancer cells
   Cwoe_4949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ADB53360
UniProt: D3FC65
Position
5280223..5281668
Genome map
AA seq 481 aa AA seqDB search
MALPDPHVIVLFGATGDLARRKLLPGLLRLYRAGLMPPDFRIVGTSLDPFDDASFRALAR
EAVEQFPRSGSGVDDASSWAEFSRRLSFVPGTAGPGALADRVHAARSELGGGRLLHYLSV
PPSAARAVVRELGDTGLSEGARIVMEKPFGTDLASAQELNGALHGVFAEQQIFRIDHFLG
KEAAQNILALRFANGLFEPIWNRQHIDHVLIEVPETLSIGMRGSFYEGTGAYRDMVVTHL
FQVLAFVAMEPPTALEPRAITEEKNKVFRSLKPLDPACVVRGQYDGYRDEPGVAADSETE
TYVALRAEIDNWRWSGVPFYLRTGKRMADSGRIISIAYHEPPHGMFPAGSGVGSFGPDHM
TFDLDEASRLSLSFYGKRPGPGMRLEKASMQFSLEETGLGHDVLEAYERLIHDAMMGDHT
LFTTADGIERLWEVSAPLLADPPPLEPYPPGSWGPPSQDELIAPHRWRLPFERKWRSNAV
R
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggcgctccccgatccccacgtcatcgtcctgttcggcgcgaccggggacctggcgaga
cgcaagctgctgccgggcctgctgcggctctaccgcgccgggttgatgccgccggacttc
cgcatcgtcggcacgtcgctggacccgttcgacgacgcgagcttccgcgccctcgctcgc
gaggcggtcgagcagttcccgcgcagcggcagcggcgtcgacgacgccagctcgtgggcg
gagttctcgcggcggctgagcttcgtgcctggcaccgccgggccgggcgcgctggccgac
cgcgtgcacgccgcgcgctcggagctgggcggcgggcgcctcctgcactacctcagcgtg
ccgccgagcgccgcccgcgcggtcgtcagagagctcggcgacaccggcctctccgagggc
gcgcggatcgtgatggagaagccgttcgggaccgatctggcgagcgcgcaggagctcaac
ggcgcgctgcacggggtcttcgccgagcagcagatcttccgcatcgaccacttcctcggc
aaggaggcggcgcagaacatactcgcgctgcgcttcgccaacggcctgttcgagccgatc
tggaaccgccagcacatcgaccacgtgctgatcgaggtgcccgagacgctgtcgatcggc
atgcgcgggtcgttctacgaaggcaccggcgcctaccgcgacatggtcgtgacgcacctc
ttccaggtgctggcgttcgtcgcgatggagccgccgacggcgctggagccgcgcgctatc
acggaggagaagaacaaggtcttccgctcgctcaagccgctggacccggcgtgcgtcgtg
cgcggccagtacgacggctatcgcgacgagcccggcgtcgcggccgactccgagaccgag
acgtacgtcgcgctgagagcggagatcgacaattggcgctggtcgggcgtgccgttctac
ctgcgcacgggcaagcggatggcggacagcgggcggatcatctcgatcgcctaccacgag
ccgccgcacgggatgttcccggccggctccggcgtcggctcgttcggccccgaccacatg
acgttcgacctcgacgaggcgtcacgcctgtcgctctcgttctacggcaagcggcccggc
ccggggatgcggctggagaaggcgagcatgcagttctcgctggaggagacggggctcggc
cacgacgtgctggaggcgtacgagcgcctgatccacgacgcgatgatgggcgaccacacg
ctcttcacgaccgccgacggcatcgagcggctctgggaggtgtcggcacccctgctcgcc
gacccgccgccgctggagccctacccgcccggctcatggggcccaccctctcaggacgag
ctgatcgctccccaccgctggcgtctgccgttcgagcgcaagtggcgctcgaacgccgtt
cgttga

DBGET integrated database retrieval system