KEGG   Conexibacter woesei: Cwoe_4952Help
Entry
Cwoe_4952         CDS       T01153                                 

Definition
(GenBank) hypothetical protein
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4079 Rax2
Motif
Other DBs
NCBI-ProteinID: ADB53363
UniProt: D3FC68
Position
5282994..5283419
Genome map
AA seq 141 aa AA seqDB search
MEDLIETVTRGNPTEVKVVLASVALALGCYQLLLIAVGYGKLRPAFLSGRAASFSHRAVG
DAIAVLLVVVALMCVTLFGFEDDAGTHVAAGSGLIAVLAVKVVVVRRSRGSSRALPPLGF
AVFALLALTWATSAGQFLGDR
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
gtggaggacctgatcgagaccgtcacgcgcggcaacccgaccgaggtcaaggtcgtgctc
gcgtcggtcgcgctggcgctcggctgctaccagctgctgctgatcgcggtcggctacggg
aagctgcgtccggcgttcctgtccggccgtgccgcgtcgttctcccaccgcgccgttggc
gacgcgatcgccgtcctgctcgtcgtcgtcgcgctgatgtgcgtgacgctgttcggcttc
gaggacgacgccggcacgcacgtcgccgccggcagcgggctgatcgccgtgctcgcggtg
aaggtcgtcgtcgtgcgccgctcgcgcggctccagccgcgcgctgccgccgctcggcttc
gccgtcttcgccctgctcgccctgacgtgggcgacctccgccggccagttcctgggggac
cgatga

DBGET integrated database retrieval system