KEGG   Conexibacter woesei: Cwoe_4958Help
Entry
Cwoe_4958         CDS       T01153                                 

Definition
(GenBank) hypothetical protein
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Baseplate_J
Motif
Other DBs
NCBI-ProteinID: ADB53369
UniProt: D3FC74
Position
complement(5290184..5291485)
Genome map
AA seq 433 aa AA seqDB search
MTQYGVSPDGFDIKGLDAILAESFERARAVFDSPDLTATSPLRKVLEVAAAEDAELWKRM
ESLYYANFASTATGASLDRLGEDLGVERDFEFATGEVRFRLGRGAPGRRYRVPEGTVVTT
AGGTVAFHTLAPLELTADATDGVTEVRAFERGVAGNVVARAIVQVDPEYAAEELSLGPAT
LAVENQLGMTGGDLLQSDADYRPRLLGRPRNLWTLESVRREVLEVPGAIDALVADALGGV
DVSQSYFDLFDFGQRQFSADRRLGEPYFFDVVVAHEFARPWRDLGAVRGVYERVQAAVDG
VRPPGIYANVIQADHIEVGVRARVSVDPGQDVQALLAAIKQRLAHDVAALRLGGAFLFSQ
TMRAFVEQPGVVDVQNVHLRRCPAAYGRVSFGGVPFQSAIVEMSVGENVQMGRTEIAIFR
LDSELIQIEVVPA
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcaatacggggtctcgcccgacggcttcgacatcaagggactcgacgcgatcctg
gcggagagcttcgagcgcgcgcgggcggtcttcgactcgcccgacctgaccgcgacgagc
ccgctgcgcaaggtgctcgaggtcgcggcggcggaggacgccgagctgtggaagcggatg
gagtcgctgtactacgcgaacttcgcctcgaccgcgacgggcgcgagcctcgaccggctc
ggcgaggacctcggcgtcgagcgcgacttcgagttcgcgaccggagaggtcagattcaga
ctcggcagaggcgcgcccggacgccgctaccgcgtcccggaggggacggtcgtgacgacg
gccggcggcacggtcgcgttccacacgctcgcgccgctggagctgacggccgacgcgacc
gacggcgtgacggaggtgcgcgcgttcgaacgcggcgtcgccggcaacgtcgtggcgaga
gcgatcgtgcaggtcgatcccgaatacgccgccgaggagctgtcgctcggcccggcgacg
ctcgcggtcgagaaccagctcggcatgaccggcggcgacctgctccagtccgacgccgac
taccggccgcggctgctcggccggccccgcaacctgtggacgctggagagcgtgcggcgc
gaggtgctcgaggtcccgggcgcgatcgacgcgctcgtcgccgacgcgctcggcggcgtc
gacgtctcgcagagctacttcgacctgttcgacttcggccagcggcagttcagcgccgac
cgccgcctcggcgagccgtacttcttcgacgtcgtcgtcgcgcacgagttcgcgcggccg
tggcgcgacctcggcgccgtcagaggggtctacgagcgcgtgcaggcggcggtcgacggc
gtgcgcccgccgggcatctacgcgaacgtgatccaggccgaccacatcgaggtcggcgtg
cgggcgcgcgtcagcgtcgaccccgggcaggacgtgcaggcgctgctcgccgcgatcaag
cagcggctcgcgcacgacgtcgccgccttgcggctcggcggcgcgttcctcttctcgcag
acgatgcgcgcgttcgtcgagcagcccggcgtcgtcgacgtgcagaacgtgcacctgcgc
cgctgcccggccgcgtacggccgcgtctcgttcggcggcgtgccgttccagtcggcgatc
gtcgagatgtcggtcggcgagaacgtgcagatgggccgcaccgagatcgcgatcttccgg
ctcgacagcgagctgatccagatcgaggtggtccccgcgtga

DBGET integrated database retrieval system