KEGG   Conexibacter woesei: Cwoe_4965Help
Entry
Cwoe_4965         CDS       T01153                                 

Definition
(GenBank) hypothetical protein
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADB53376
UniProt: D3FC81
Position
complement(5294925..5296904)
Genome map
AA seq 659 aa AA seqDB search
MEALLHRPTLTDPPDGLSADDRRRLLETVARAAERAAAAAGVAPRWAGAVADAATATATA
IETELGISTAAQAAQAPLGPARRGPSRSQQATPAGASQPLPPGGELTTSAGERIVNAAFP
SRVVLARGGSGAAGTVRAGGRPYVRAATLARAAAWGRLLHAAHGFAVLAAASGELPFHAV
PLERPLDARDLGPLGEQPSGSGAASAAAAAAQRPALVAAADFAPVLVVTRDDRELRAGDG
ARPALAAPTAQTSEPIAAADVAAVRAALPELGAVAAAAAPPLAAPEPVVLEGETVYSELV
VLPRALLLAMPWQRRAAFLQQLAAAPAGQRERTAIRDLLRATRSLGEIEASVALLRRAGA
FSDLIGRLDEDAYDVIALLGAYRGGPAPAWPRLVPVVADERARTPAPDPDAPLLPRVDEE
SRRIVALTSDPPNALLGLRHVAELDWTFSRAQAGDRGARELAATLALRAARQIGPLLVGL
GYATEVGTGPDTGGEPLPDALVAQVRIAIVAELAARLVAIRELRTALAAPTLAQRIGALA
RALPGLRLPEDRQPELTLRLAGKLPASRVQELLHTLGFVPPEYVAAWSTEQLVALGSRPR
AMAFVREAGGETFVAVLRRGGGDWSRFERFLDALAAKRARIADPEAWQRLLDRLATHGL
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
gtggaggcgctgctgcaccgaccgacgctgaccgatccgcccgacgggctgagcgccgac
gaccggcgccgcctgctggagacggtcgcgcgtgcggccgagcgcgcggcagccgctgcg
ggcgtcgcgccgcgctgggccggcgcggtcgcggacgccgcgacggcgacggcgaccgcg
atcgagacggagctggggatctcgaccgcggcgcaggctgcgcaggcgccgctcgggccc
gcgcggcgcgggccgtcgcgctcgcagcaggcgacgcccgccggggcgtcgcagccgctg
ccgcccggcggcgagctgacgacgagcgccggcgagcggatcgtgaacgccgccttcccc
tcgcgggtggtgctcgcgcgtggcggcagcggcgccgccgggaccgtgcgtgcgggcggc
cggccgtacgtgcgcgccgccacgcttgcgcgcgccgccgcctggggccgcctgctgcac
gcggcccacggcttcgcggtgctcgcggcggcgagcggggagctgccgttccacgccgtc
ccgctcgagcgcccgctcgacgcccgcgatctcggtccgctcggcgagcagccgtccggc
agcggcgccgcgagcgctgccgccgcggccgcgcagcgcccggcgctcgtcgccgccgcc
gacttcgcgcccgtgctcgtcgtgacgcgcgacgaccgcgagctgcgcgcgggcgacggc
gcgcgaccggcgctcgccgcccccacagcacagacgtccgagccgatcgccgccgccgac
gtcgccgcggtgcgcgccgcgctgccggagctcggcgccgtcgccgcggcggctgcgccg
ccgctcgccgcgccagagccggtcgtgctcgaaggcgagaccgtctactccgagctggtg
gtgctcccgcgcgcgctgctgctcgcgatgccgtggcagcggcgcgccgccttcctgcag
cagctcgccgcggcgcccgcgggccagcgcgagcgcacggcgatccgcgacctgctgcga
gcgacgcgctcgctcggcgagatcgaggcgagcgtcgcgctgctgcgccgcgcgggtgcg
ttcagcgatctgatcggccgcctcgacgaggacgcctacgacgtgatcgcgttgctcggc
gcctaccgcggcggtccggcgccagcgtggccgcggctcgtccccgtcgtcgccgacgag
cgcgcgcggacgccggcgcccgacccggacgcgccgctgctcccgcgggtcgacgaggag
agccggcggatcgtggcgctgacgtcggatccgccgaacgcgctgctgggtctgcggcac
gtggcggagctggactggaccttcagccgcgcgcaggcgggcgaccgcggcgcgcgcgag
ctggcggcgacgctcgcgctgcgcgccgcgagacagatcgggccgctgctcgtcgggctc
ggctacgcgacggaggtcggcaccggaccggatacgggcggcgagccactgcccgacgcg
ctcgtcgcgcaggtgcggatcgcgatcgtggccgagctggcggcgcgcctcgtcgcgatc
cgcgagctgcggaccgcgctcgcggcgccgacgctcgcgcagcggatcggcgcgctcgca
cgtgcgctgcccggcctgcgcctgcccgaggaccgccagcccgagctgacgctgcggctg
gcgggcaagctgccggcctcgcgcgtgcaggagctgctccacacgctcgggttcgtgccg
cccgagtacgtcgccgcgtggtcgaccgagcagctcgtcgcgctcggctcgcgcccgcgg
gcgatggcgttcgtgcgcgaggcgggcggcgagacgttcgtcgccgtgctgcggcgcggg
ggcggcgactggagccgcttcgaacgcttcctcgacgcgctcgcggcgaagcgcgcgcgg
atcgccgacccggaggcgtggcagcgcctgctcgaccgcctcgcgacccacggcctctga

DBGET integrated database retrieval system