KEGG   Conexibacter woesei: Cwoe_4971Help
Entry
Cwoe_4971         CDS       T01153                                 

Definition
(GenBank) transcriptional regulator, SARP family
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BTAD
Motif
Other DBs
NCBI-ProteinID: ADB53382
UniProt: D3FC87
Position
complement(5299695..5300480)
Genome map
AA seq 261 aa AA seqDB search
MTGVMVQGRATAAPAQHETTQTQTRDEPLRLTLLGGFELRHGGEQVELPASAQRLVAFLA
IRARPLQRLHVAGSLWLDAPEERANAALRTALWRSRRRGCPLVDARGPSIGLAPGVEVDL
HASARLARTVLESPPRKIVELAGLDHVWANGELLPDWYDDWVLIERERHRQLRLHALEAL
CEALTVAGRHGEAIEAGIAAVASEPLRESAHRVLICVHLAEGNVAEALRQYRLFGELLRD
QLGLDPSARLRELIERAVTLR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaccggggtcatggtgcagggacgcgcgacggcggcgcctgcgcagcacgagacgaca
cagacgcagacgcgcgacgaaccgttgcggctgacgctgctcggcggcttcgagctgcgg
cacggcggcgagcaggtcgagctgcccgccagcgcgcagcggctcgtcgcgttcctggcg
atccgcgcgcgcccgctccagcgtctccacgtcgccggcagcctctggctcgacgcgccg
gaggagcgcgcgaacgccgcgctgcggacggcgctgtggcgcagccgccggcgcggctgc
ccgctcgtcgacgcgcgcggaccgagcatcggcctcgcgcccggcgtcgaggtcgacctg
cacgcctccgcgcggctcgcgcggacggtgctggagagcccgccccggaagatcgtcgag
ctggccggtctcgaccacgtctgggcgaacggcgagctgctgcccgactggtacgacgac
tgggtgctgatcgagcgcgaacgccaccggcagctgcggctgcacgcgctggaggcgctg
tgcgaggcgctcaccgtcgcgggccggcacggcgaggcgatcgaggcggggatcgccgcg
gtcgcgtccgagccgctgcgcgagagcgcccaccgcgtgctgatctgcgtccatctcgcg
gaggggaacgtcgccgaggcgctgcgccagtaccgtctcttcggcgagctgctgcgcgac
cagctcgggctcgacccctcagcgcgcctgcgcgagctgatcgagcgcgccgtgacgctg
cggtga

DBGET integrated database retrieval system