KEGG   Conexibacter woesei: Cwoe_4975Help
Entry
Cwoe_4975         CDS       T01153                                 

Definition
(GenBank) PAS/PAC sensor signal transduction histidine kinase
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HisKA_3 HATPase_c PAS_4 HATPase_c_2 HATPase_c_3 PAS
Motif
Other DBs
NCBI-ProteinID: ADB53386
UniProt: D3FC91
Position
5304450..5305430
Genome map
AA seq 326 aa AA seqDB search
MLPPLLALTPDPTLVIDRHGTIAAADARLGELVGWEPAELVGRCFDALVPQGVLDPDLRL
TARSADGGEIPIEISVRVVEGIDGVAGPALAVAIRDVTLRRRRAAGLRASAERFRMQAAE
AERARWARELHDETLQGLAALHVLLSSGVRAKTPELMRERIGLAQEQIEGAMENLRGLIN
DLRPAALDELGLEASVRDLAERVQSVYGIEIETRVALRGDDGAPRRLATEVETTAYRVVQ
ECLSNAARHAGATRIAVEITQPHGAATLRVRVRDDGHGFAAEETDSGGGYGLRSMRERVD
LLEGELTLSSGSDAGTEIVAVLPLTS
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgcttcccccgctgctcgcgctgacgcccgacccgacgctcgtgatcgaccgccacggc
acgatcgccgcggccgacgcgcgcctcggcgagctggtcggctgggagccggcggagctg
gtcgggcgctgcttcgacgcgctcgtgccgcagggcgtgctcgaccccgacctgagactg
accgcccgcagcgccgacggcggcgagatcccgatcgagatctccgtccgcgtcgtcgag
gggatcgacggcgtcgccggacccgcgctcgcggtcgcgatccgcgacgtgacgctgcgc
cgccgcagagccgccgggctgagagcgtccgccgagcgcttccggatgcaggcggccgag
gcggagcgcgcccgctgggcgcgcgagctgcacgacgagacgttgcaggggctcgctgcg
ctgcacgtgctgctctcctccggcgtgcgcgcgaagacgccggagctgatgcgcgagcgg
atcgggctcgcgcaggagcagatcgagggcgcgatggagaacctgcgcgggctgatcaac
gacctgcggcccgccgcgctcgacgagctgggcctggaggcgtcggtccgcgacctcgcc
gagcgcgtgcagagcgtctacgggatcgagatcgagacgcgcgtcgcgctgcgcggcgac
gacggcgccccgcggcggctcgcgaccgaggtcgagacgaccgcctaccgcgtcgtgcag
gagtgcctctccaacgccgcccggcatgcgggcgcgacccgcatcgcggtcgagatcacc
cagccgcacggcgccgcgaccctccgcgtccgcgtgcgcgacgacggccacggcttcgcc
gccgaggagaccgacagcggcggcggctacggcctgcgctcgatgcgcgagcgcgtcgac
ctgctcgaaggcgagctgacgctgtcgagcggcagcgacgccggcaccgagatcgtcgcc
gtgctgccgctgactagctga

DBGET integrated database retrieval system