KEGG   Conexibacter woesei: Cwoe_4977Help
Entry
Cwoe_4977         CDS       T01153                                 

Definition
(GenBank) chalcone and stilbene synthase domain protein
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAE1_CUT1_RppA Chal_sti_synt_C ACP_syn_III_C Chal_sti_synt_N ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ADB53388
UniProt: D3FC93
Position
5306213..5307310
Genome map
AA seq 365 aa AA seqDB search
MNSATLAPTPAASGAAARRAGPLPTIAGLATAAPPQVYEQRDMLALLGLAGDEFAEGIFD
RCGVQRRHLGTPPELWATTLQARTAHTERLLAGLATQAVDQLDFDPADVAVVVAGTYYGL
GGPTIAHRIVEHCGLAPETDKYHLLGVGCASAVPLLRLAAQALSDHPGKQALVVAAECVS
GFLTTCAPGDAKVKIVGSSLFGDGCAAALLTLGEAREDTTPRPRILDSVVHQIPDSLDEV
RFAVTADDSHMNMSRALPVIAANDLRGLVDDFLARSGLTRGDVDHWIAHPGGRGILDGIR
AGLELTEEDVAPSAAVLAENGNVGTPSALFVLERVHELRDPQPGERGLMVTIGPGVTIGM
ALVQW
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaactccgccacgctcgccccgactcccgccgcatccggtgccgccgcacgccgcgcc
ggaccgcttccgacgatcgccggcctcgccacggccgcgcccccgcaggtctacgagcag
cgcgacatgctcgcgctgcttggcctcgccggcgacgagttcgccgaagggatcttcgac
cgctgcggcgtccagcgccgccatctcggaacgccgccggagctgtgggcgacgacgctg
caggcgcgcaccgcgcacaccgagcggctgctcgccgggctcgcgacgcaggccgtcgac
cagctcgacttcgaccccgccgacgtcgcggtcgtcgtcgcgggcacctactacggactc
ggcggcccgacgatcgcccaccgcatcgtcgagcactgcggcctcgcgcccgagaccgac
aagtaccacctgctcggcgtcggctgcgcctccgccgtcccgctgctgcggctcgccgcg
caggcgctgagcgaccatcccggcaagcaggcgctcgtcgtcgcggcggagtgcgtcagc
ggcttcctgacgacctgcgcgccaggcgacgcgaaggtcaagatcgtcggctcctcgctg
ttcggcgacggctgcgccgccgcgctgctgacgctcggcgaggcgcgcgaggacacgacg
ccgcgcccgcggatcctcgacagcgtcgtccaccagatccccgactcgctcgacgaggtc
cgcttcgccgtcaccgccgacgacagccacatgaacatgagccgcgcgctgccggtgatc
gccgcgaacgacctgcgcgggctcgtcgacgacttcctcgcgcggagcgggctcacgcgc
ggcgacgtcgaccactggatcgcccaccccggcggccgcgggatcctcgacggcatccgc
gccgggctggagctgacggaagaggacgtcgcgccgagcgccgcggtgctcgccgagaac
ggcaacgtcggcacgccgtcggcgctgttcgtgctggagcgcgtgcacgagctgcgcgat
ccgcagccgggcgagcgcggcctgatggtgacgatcggaccgggcgtgacgatcggcatg
gcgctggtgcagtggtga

DBGET integrated database retrieval system