KEGG   Conexibacter woesei: Cwoe_4979Help
Entry
Cwoe_4979         CDS       T01153                                 

Definition
(GenBank) Na+/H+ antiporter
  KO
K03316  monovalent cation:H+ antiporter, CPA1 family
Organism
cwo  Conexibacter woesei
Brite
KEGG Orthology (KO) [BR:cwo00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Cwoe_4979
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_H_Exchanger
Motif
Other DBs
NCBI-ProteinID: ADB53390
UniProt: D3FC95
Position
5308012..5309673
Genome map
AA seq 553 aa AA seqDB search
MVSPLTSPASPFPLAAASEGGGAHFDVVLLGVLAGVTVLLLLAYHSRVPYPIWLVVGGGA
LAFVPGLPQVELDPDLVLLVILPPLLYAAAFFSSLRDLRANLRPIGMLAIGLVVATTLVV
GVVAHMVVDDLSWAAAFTLGAVLSPTDPVAATAIASRAGAPRRFVTIVEGESLVNDSTAL
IIYKAAVAAVLTGSFSLLDAGFDFVMGAAAGIAIGIAIGAVIARIRRVVDDPPTEITISL
LTPYFAYLPAEALGVSAVLAAVTSGIWLGWRSPELITPATRIQAFSVWEILVFVLNAALF
VLVGLQLPGIVEQISDDYAAGQLALWGALVAVTVILVRFAWVFPLTYLPGLLSRRVRERN
PFPPVTSVLLISWTGMRGAVSLAAALAIPLTLDDGSPFPGRDLIVFLVYVTILVTILAQG
LTLAPLIRLLGVEDDGKVERLEAKARVKAAKRAIARIDELAAEDWVGDLTAERMRGLYEF
RIQRFRSRFDDEDDGAVEARSLAYQRLRREALGAERAEIIRLRNEGVINDAVLHTIERDL
DLEDTRLDLDGSG
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcgccgctcacgtctcccgcctcgccgttcccgctcgccgccgcctccgagggt
ggcggcgcgcacttcgacgtcgtcctgctcggcgtgctcgccggcgtgacggtcctgctg
ctgctcgcgtaccactcgcgcgtcccgtacccgatctggctcgtcgtcggcggtggcgcg
ctcgcgttcgtgccgggcctcccgcaggtcgagctcgacccggacctcgtcctgctcgtg
atcctgccgccgctgctctatgcggcggcgttcttctcgtcgctgcgcgacctgcgcgcg
aacctgcgcccgatcgggatgctcgcgatcgggctcgtcgtcgccacgacgctcgtcgtc
ggcgtcgtcgcgcacatggtcgtcgacgacctcagctgggccgcggccttcacgctcggc
gcggtgctgtccccgaccgacccggtcgccgcgaccgcgatcgcctcgcgcgcgggggcg
ccgcgccgcttcgtcacgatcgtcgagggcgaatcgctcgtcaacgactcgaccgcgctg
atcatctacaaggcggccgtcgcggcggtgctgaccggctcgttctcgctgctcgacgcc
ggcttcgacttcgtcatgggcgcggccgccgggatcgcgatcgggatcgcgatcggtgcc
gtgatcgcgcggatccggcgggtcgtcgacgacccgccgaccgagatcacgatctcgctg
ctgacgccgtacttcgcctacctgccggcggaggcgctcggcgtcagcgccgtgctggcg
gcggtgacctccggcatctggctcggctggcgctcgccggagctgatcacgcccgcgacg
cgaatccaggcgttctcggtctgggagatcctcgtgttcgtcctcaacgcggcgctgttc
gtgctcgtcggcctgcagctgccggggatcgtcgagcagatctccgacgactacgccgcc
ggccagctcgcgctgtggggcgcgctggtcgcggtgaccgtgatcctcgtccgcttcgcg
tgggtcttcccgctcacctacctgcccggcctgctctcgcgccgcgtgcgcgaacgcaac
ccgttcccgccggtgacgagcgtcctgctgatctcctggacgggcatgcgcggcgccgtc
tcgctcgccgccgcactcgcgatcccgctgacgctcgacgacggcagcccgttccccggc
cgcgacctgatcgtcttcctcgtctacgtcacgatcctcgtgacgatcctggcgcagggg
ttgacgctggcgccgctgatccgcctgctcggcgtcgaggacgacggcaaggtcgagcgg
ctggaggcgaaggcgcgcgtgaaggcggcgaagcgggcgatcgcgcggatcgacgagctg
gccgccgaggactgggtcggcgacctcaccgccgagcggatgcgcgggctctacgagttc
cgcatccagcgcttccgctctcgcttcgacgacgaggacgacggcgcggtggaggcgagg
tcgctcgcctaccagcggctgcgccgcgaggcgctcggggcggagcgcgccgagatcatc
cggctgcgcaacgagggcgtcatcaacgacgcggtgctgcacacgatcgagcgcgacctc
gacctcgaggacacgcggctcgacctcgacggctcgggctag

DBGET integrated database retrieval system