KEGG   Conexibacter woesei: Cwoe_4992Help
Entry
Cwoe_4992         CDS       T01153                                 

Definition
(GenBank) inner-membrane translocator
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2
Motif
Other DBs
NCBI-ProteinID: ADB53403
UniProt: D3FCA8
Position
complement(5323220..5324296)
Genome map
AA seq 358 aa AA seqDB search
MSVTEAVGATAPGPAPEPDFRPAGRHRVRRLLAGRQTALTAVAALLFVFFSIFGTRFLTL
DNVYDMARISTFLLIVGVPLTMLFIAREIDISVGSQYGLATVLMAVFIVNWGLDPWLAAG
LTVIAGGLMGSINAVVCTVVGVPSFICTLGMYSLLRGLSYVITGGQPITYPMELESSFFT
IANGTIGDFPVEVLWAAAVVAIGAFALHFTPFGAHVYATGGNDKAARASGISTRRVRFLC
FVLVGLSCGLSGAITGGWLLEGSPSTGTGFELQVFAAIIIGGVALTGGDGSIYGAVLGVA
IVGMLANGLVLIGAQANWNDFFVGLIIVLVATIEVAINRRSTIARALRQLLPRNRTAG
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgaccgaagccgtcggcgcgaccgcgccggggccggcgcccgagcccgacttc
cgcccggccggccgccaccgcgtgcgccgcctgctggccggccggcagaccgcgctgacc
gccgtcgcggcgctgctgttcgtcttcttctcgatcttcgggacgcgcttcctgacgctc
gacaacgtctacgacatggcccgcatcagcacgttcctgctgatcgtcggcgtgccgctg
acgatgctcttcatcgcgagagagatcgacatctcggtcggctcgcagtacggcctcgcg
accgtcctgatggccgtcttcatcgtgaactggggcctggacccgtggctcgcggccggc
ctgaccgtgatcgcgggcggtctgatggggtcgatcaacgcggtcgtctgcacggtcgtc
ggcgtgccgtcgttcatctgcacgctcggcatgtacagcctgctgcgcgggctctcgtac
gtgatcacgggcgggcagccgatcacctatccgatggagctggagtcgagcttcttcacg
atcgccaacggcacgatcggcgacttcccggtcgaggtgctgtgggccgccgcggtcgtc
gcgatcggcgccttcgcgctccacttcacgccgttcggcgcgcacgtctacgcgaccggc
ggcaacgacaaggcagcccgcgcgagcggcatctcgacgcgtcgcgtgcgcttcctctgc
ttcgtcctcgtcggcctctcgtgcggcctctcgggcgcgatcacgggcggctggctgctg
gaggggagcccgtcgacgggcaccggcttcgagctgcaggtgttcgccgcgatcatcatc
ggcggcgtcgcgctgacgggcggcgacggcagcatctacggggcggtcctgggcgtcgcg
atcgtcgggatgttggccaacggcctcgtcctgatcggcgcgcaggcgaactggaacgac
ttcttcgtcgggctgatcatcgtgctggtcgcgacgatcgaggtggcgatcaaccgccgg
tcgacgatcgcgcgggcgctgcggcagctgctgccgcgcaatcgcaccgccgggtaa

DBGET integrated database retrieval system