KEGG   Conexibacter woesei: Cwoe_4998Help
Entry
Cwoe_4998         CDS       T01153                                 

Definition
(GenBank) Glutamine--fructose-6-phosphate transaminase (isomerizing)
  KO
K00820  glucosamine---fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
cwo  Conexibacter woesei
Pathway
cwo00250  Alanine, aspartate and glutamate metabolism
cwo00520  Amino sugar and nucleotide sugar metabolism
cwo01100  Metabolic pathways
cwo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cwo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Cwoe_4998
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Cwoe_4998
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cwo01002]
    Cwoe_4998
Enzymes [BR:cwo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     Cwoe_4998
Peptidases [BR:cwo01002]
 Cysteine Peptidases
  Family C44
   Cwoe_4998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SIS
Motif
Other DBs
NCBI-ProteinID: ADB53409
UniProt: D3FCB4
Position
5329533..5330570
Genome map
AA seq 345 aa AA seqDB search
MSAAGSIMAAEMAEQPDVLARFSARFSAEAARVAAVVPRPLAGVVFAARGSSDHAAVHGR
YLAQLTSGRPAGLAAPSLHTRYDARTDYSGHLVVALSQSGATPEIVTLCERVRAGGARCV
AIVNDVASPLGTAADVAIGLGAGPELAVPATKTVTAQLLAVTAVAAALGPLPFGAGADQA
LAALPAAVAAALADPAPAELLAARWRDAERMVVTARGLLQAVALETALKVKETTGILAEG
LSAADLRHGPIAAVGPAVAVLGFDAGGPASGDLEELADVVAARGAALARCAPDAGAELPL
PGALPEPLAAIVATVRGQQLARSLALARGLDPDAPPSLSKVTATY
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgccggttcgatcatggcggccgagatggccgagcagccggacgtgctggcg
cgcttctccgcgcgcttcagcgccgaggcggcgcgtgtcgcggccgtcgtcccgcgaccg
ctcgccggcgtcgtcttcgccgcgcgcggctcctccgaccacgccgccgtccacggccgc
tacctcgcgcagctcacgtccgggcgccccgccggcctcgcggcgccgagcctccacacg
cgctacgacgcccgcaccgactactccggccacctcgtcgtcgcactcagccagtcgggc
gcgacgccggagatcgtgacgctgtgcgagcgcgtccgggccggcggcgcgcgctgcgtc
gcgatcgtcaacgacgtcgcgagcccgctcggcaccgccgccgacgtcgcgatcggcctc
ggcgccgggccggagctggcagtcccggcgaccaagaccgtcaccgcgcagctgctcgcc
gtgaccgccgtcgcggcggcgctcgggccgctgccgttcggggcgggagcggaccaagcg
ctcgccgcgctgccggccgccgtcgccgcggcgctcgccgatcccgcgcccgccgagctg
ctcgccgcccgctggcgcgacgccgagcggatggtcgtgaccgcccgcggcctgctccag
gcggtcgcgctggaaacggcgctgaaggtgaaggagacgaccgggatcctcgccgaagga
ctgtcggccgccgacctgcgccacgggccgatcgccgccgtcggccccgccgtcgcggtg
ctcggcttcgacgcgggcggcccggcgtccggcgacctggaggagctggcggacgtggtc
gccgcgcgcggcgcggcgctcgcgcgctgcgcgccggacgcgggcgccgagctgccgctc
ccgggcgctctgccggagccgctcgcggcgatcgtcgcgacggtgcggggccagcagctc
gcgcgctcgctcgcgctcgcgcgcggcctcgaccccgacgcgccgccgtcgctgtcgaag
gtgaccgcgacgtactga

DBGET integrated database retrieval system