KEGG   Conexibacter woesei: Cwoe_4999Help
Entry
Cwoe_4999         CDS       T01153                                 

Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
cwo  Conexibacter woesei
Pathway
cwo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cwo01100  Metabolic pathways
cwo01110  Biosynthesis of secondary metabolites
cwo01130  Biosynthesis of antibiotics
cwo01230  Biosynthesis of amino acids
cwo02024  Quorum sensing
Module
cwo_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cwoe_4999
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Cwoe_4999
Enzymes [BR:cwo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     Cwoe_4999
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: ADB53410
UniProt: D3FCB5
Position
5330639..5331712
Genome map
AA seq 357 aa AA seqDB search
MSITRHLDDVRDQRIAHVVPLVTPALMLHQLPLTDAQAEVVVRGRGDAARILDGADDRLL
VVVGPCSVHDPDAALEYARRLAPVAAEHKQDLCVAMRVYFEKPRTTTGWKGLINDPHLDG
SNDVNTGLRMARRLLLQVLELGLPVGCEFLDPIIPQYIADTVAWGAIGARTTESQTHRQL
ASGLSMPVGFKNRTDGNVGVAVDAVRAGAAPHTFAGVDVTGTPAVFTTRGNPDCHIILRG
GRGMTNYGPAQVAEALSAMHAAGLRERVIVDASHDNSGKDHERQPLVAQALAEQVAGGDR
ALVGVMLESFLVAGSQSLGDGKDLTYGQSITDKCIDWETTVDVLAGLAAAARARRTA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatcactcgacacctcgacgacgtccgcgaccagcgcatcgcccatgtcgtcccg
ctcgtgacgcccgcgctgatgctccaccagctcccgctgacggacgcccaggcggaggtc
gtcgtccgcgggcgcggcgacgccgcgcgcatcctcgacggcgccgacgaccggctgctc
gtcgtcgtcgggccgtgctcggtgcacgatcccgacgcggcgctggagtacgcccgccgg
ctcgccccggtcgccgccgagcacaagcaggacctgtgcgtcgcgatgcgcgtctacttc
gagaagccgcgcacgacgaccggctggaagggcctgatcaacgacccgcacctcgacggt
tccaacgacgtcaacaccggcctgcggatggcgcgcagactgctgctgcaggtgctggag
ctggggctcccggtcggctgcgagttcctcgacccgatcatcccgcagtacatcgccgac
accgtcgcctggggcgcgatcggcgcgcgcacgaccgagagccagacgcaccgccagctc
gcctcgggcctgtcgatgccggtcggcttcaagaaccgcacggacggcaacgtcggcgtc
gcggtcgacgccgtccgcgccggcgccgcgccacacaccttcgccggcgtcgacgtgacc
ggaacgccggccgtcttcaccacgcgcggcaacccggactgccacatcatcctgcgcggc
gggcgcggcatgacgaactacgggccggcgcaggtcgccgaggcgctgtcggcgatgcac
gccgccggcctgcgcgagcgcgtcatcgtcgacgcctcgcacgacaacagcggcaaggac
cacgagcgccagccgctcgtggcgcaggcgctggccgagcaggtcgcgggcggcgacaga
gcgctcgtcggcgtgatgctggagtcgttcctcgtcgccggcagccagagcctcggcgac
ggcaaggacctcacgtacggccagtcgatcacggacaagtgcatcgactgggagacgacg
gtcgacgtgctcgccggcctcgccgccgcggcgagagcgcgccgcaccgcctga

DBGET integrated database retrieval system