KEGG   Conexibacter woesei: Cwoe_5004Help
Entry
Cwoe_5004         CDS       T01153                                 

Definition
(GenBank) Dimethylmenaquinone methyltransferase
  KO
K10218  4-hydroxy-4-methyl-2-oxoglutarate aldolase [EC:4.1.3.17]
Organism
cwo  Conexibacter woesei
Pathway
cwo00362  Benzoate degradation
cwo00660  C5-Branched dibasic acid metabolism
cwo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    Cwoe_5004
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Cwoe_5004
Enzymes [BR:cwo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.17  4-hydroxy-4-methyl-2-oxoglutarate aldolase
     Cwoe_5004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RraA-like
Motif
Other DBs
NCBI-ProteinID: ADB53415
UniProt: D3FCC0
Position
complement(5333998..5334657)
Genome map
AA seq 219 aa AA seqDB search
MSALARDAAFAARLRAFDSATVYEANGRVGAMEPGIVPQLAGQRVAGRARTVLCSPRDNL
ALHHAVAAAEPGDVLVANALDARIGMWGEVLTIAAQARGVAGLVIDGAVRDIDAIRALGF
PIFSRALAIAGATKDVPGELDQPIACGGQLVRRGDWVLADDSGVAVLPDDRVEAALAAAE
ARIDGETRVIEGLRGGQTTVELLGLAPLPTTNTTMETPA
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgagtgccctggcccgtgacgcggctttcgccgcgcgtctgcgcgcgttcgacagcgcg
accgtctacgaggcgaacggccgcgtcggcgcgatggagccggggatcgtcccccagctc
gccggccagcgcgtcgccggccgcgcccgcacggtcctctgctcgccgcgcgacaacctc
gcgctccaccacgcggtcgccgccgcggagcccggcgacgtgctcgtcgccaacgcgctc
gacgcgcggatcgggatgtggggcgaggtgctgacgatcgccgcgcaggcgcgcggcgtc
gccggcctcgtgatcgacggcgcggtgcgcgacatcgacgcgatccgcgctctcggcttc
ccgatcttctcgcgcgcgctggcgatcgccggcgcgacgaaggacgtgccgggcgagctg
gaccagccgatcgcgtgcggcggccagctcgtgcgccgcggcgactgggtgctcgccgac
gacagcggcgtcgccgtgctccccgacgaccgcgtggaggcggcgctggccgccgcggag
gcgcgcatcgacggcgagacgcgcgtgatcgaaggactgcgcggcggccagacgaccgtc
gagctgctcgggctcgcgccccttcccaccacgaacaccacgatggagacccctgcatga

DBGET integrated database retrieval system